Overview

  • Product name

  • Description

    Rabbit polyclonal to c-Fos
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Cat, Pig, Chinese hamster
  • Immunogen

    Recombinant fragment corresponding to Human c-Fos aa 72-210.
    Sequence:

    DLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQ SIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQ LEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDL


    Database link: P01100

  • Positive control

    • Human adrenal gland tissue; RT4, U251MG, NIH 3T3 and NBT-II cell lysates; A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab209794 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 41 kDa.
IHC-P 1/50 - 1/100. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. In the heterodimer, FOS and JUN/AP-1 basic regions each seems to interact with symmetrical DNA half sites. On TGF-beta activation, forms a multimeric SMAD3/SMAD4/JUN/FOS complex at the AP1/SMAD-binding site to regulate TGF-beta-mediated signaling. Has a critical function in regulating the Has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation.
  • Sequence similarities

    Belongs to the bZIP family. Fos subfamily.
    Contains 1 bZIP domain.
  • Post-translational
    modifications

    Phosphorylated in the C-terminal upon stimulation by nerve growth factor (NGF) and epidermal growth factor (EGF). Phosphorylated, in vitro, by MAPK and RSK1. Phosphorylation on both Ser-362 and Ser-374 by MAPK1/2 and RSK1/2 leads to protein stabilization with phosphorylation on Ser-374 being the major site for protein stabilization on NGF stimulation. Phosphorylation on Ser-362 and Ser-374 primes further phosphorylations on Thr-325 and Thr-331 through promoting docking of MAPK to the DEF domain. Phosphorylation on Thr-232, induced by HA-RAS, activates the transcriptional activity and antagonizes sumoylation. Phosphorylation on Ser-362 by RSK2 in osteoblasts contributes to osteoblast transformation.
    Constitutively sumoylated by SUMO1, SUMO2 and SUMO3. Desumoylated by SENP2. Sumoylation requires heterodimerization with JUN and is enhanced by mitogen stimulation. Sumoylation inhibits the AP-1 transcriptional activity and is, itself, inhibited by Ras-activated phosphorylation on Thr-232.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Activator protein 1 antibody
    • AP 1 antibody
    • C FOS antibody
    • Cellular oncogene c fos antibody
    • Cellular oncogene fos antibody
    • FBJ murine osteosarcoma viral (v fos) oncogene homolog (oncogene FOS) antibody
    • FBJ murine osteosarcoma viral oncogene homolog antibody
    • FBJ murine osteosarcoma viral v fos oncogene homolog antibody
    • FBJ Osteosarcoma Virus antibody
    • FOS antibody
    • FOS protein antibody
    • FOS_HUMAN antibody
    • G0 G1 switch regulatory protein 7 antibody
    • G0/G1 switch regulatory protein 7 antibody
    • G0S7 antibody
    • Oncogene FOS antibody
    • p55 antibody
    • proto oncogene c Fos antibody
    • Proto oncogene protein c fos antibody
    • Proto-oncogene c-Fos antibody
    • v fos FBJ murine osteosarcoma viral oncogene homolog antibody
    see all

Images

  • Immunohistochemical analysis of Paraffin-embedded Human adrenal gland tissue labeling c-Fos with ab209794 at 1/50 dilution.

  • Immunofluorescent analysis of A431 cells (PFA-fixed/Triton X-100 permeabilized) labeling c-Fos with ab209794 at 4 μg/ml (green).

  • All lanes : Anti-c-Fos antibody (ab209794) at 1/100 dilution

    Lane 1 : NIH 3T3 cell lysate
    Lane 2 : NBT-II cell lysate

    Predicted band size: 41 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human cerebral cortex tissue sections labelling c-Fos with ab209794.

  • All lanes : Anti-c-Fos antibody (ab209794) at 1/100 dilution

    Lane 1 : RT4 cell lysate
    Lane 2 : U251MG cell lysate

    Predicted band size: 41 kDa

References

This product has been referenced in:

  • Pu ZH  et al. Alkaloids from the rhizomes of Ligusticum striatum exert antimigraine effects through regulating 5-HT1B receptor and c-Jun. J Ethnopharmacol 237:39-46 (2019). Read more (PubMed: 30880256) »
  • Gao J  et al. In vitro and in vivo study of the expression of the Syk/Ras/c-Fos pathway in chronic glomerulonephritis. Mol Med Rep 18:3683-3690 (2018). Read more (PubMed: 30106104) »
See all 8 Publications for this product

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Thymus)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Bond TM Epitope Retrieval 1 (Leica Biosystems)
Permeabilization
No
Specification
Thymus
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Feb 15 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up