For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    c-jun-antibody-ab31419.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling Transcription Domain Families HLH / Leucine Zipper Leucine Zipper
Share by email

Anti-c-Jun antibody (ab31419)

  • Datasheet
  • SDS
Reviews (13)Q&A (8)References (72)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-c-Jun antibody (ab31419)
  • Immunocytochemistry/ Immunofluorescence - Anti-c-Jun antibody (ab31419)
  • Western blot - Anti-c-Jun antibody (ab31419)
  • Western blot - Anti-c-Jun antibody (ab31419)

Key features and details

  • Rabbit polyclonal to c-Jun
  • Suitable for: ELISA, ICC/IF, IP, ChIP, Flow Cyt, IHC-P, WB
  • Reacts with: Mouse, Rat, Human, African green monkey
  • Isotype: IgG

Get better batch-to-batch reproducibility with a recombinant antibody

Product image
Anti-c-Jun antibody [E254] - ChIP Grade (ab32137)
  • Research with confidence – consistent and reproducible results with every batch
  • Long-term and scalable supply – powered by recombinant technology for fast production
  • Success from the first experiment – confirmed specificity through extensive validation
  • Ethical standards compliant – production is animal-free

Overview

  • Product name

    Anti-c-Jun antibody
    See all c-Jun primary antibodies
  • Description

    Rabbit polyclonal to c-Jun
  • Host species

    Rabbit
  • Specificity

    Antibody detects endogenous levels of c-Jun protein around Serine 243.
  • Tested applications

    Suitable for: ELISA, ICC/IF, IP, ChIP, Flow Cyt, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human, African green monkey
    Predicted to work with: Chicken, Cow, Pig
  • Immunogen

    Synthetic peptide within Human c-Jun aa 210-259. The exact sequence is proprietary.
    Sequence:

    HLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKR


    Database link: P05412
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol, 0.87% Sodium chloride

    Without Mg2+ and Ca2+
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Epigenetics and Nuclear Signaling
    • Transcription
    • Domain Families
    • HLH / Leucine Zipper
    • Leucine Zipper
    • Signal Transduction
    • Signaling Pathway
    • Nuclear Signaling
    • SMADs
    • Epigenetics and Nuclear Signaling
    • Nuclear Signaling Pathways
    • SMADs
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Transcription Factors
    • Cancer
    • Oncoproteins/suppressors
    • Oncoproteins
    • Transcription factors
    • Immunology
    • Innate Immunity
    • TLR Signaling
    • Kits/ Lysates/ Other
    • Kits
    • ELISA Kits
    • ELISA Kits
    • Phosphoprotein ELISA kits
    • Neuroscience
    • Processes

Associated products

  • Assay kits

    • c-Jun Transcription Factor Assay Kit (Colorimetric) (ab207195)
  • ChIP Related Products

    • ChIP Kit (ab500)
  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Conjugation kits

    • PE / R-Phycoerythrin Conjugation Kit - Lightning-Link® (ab102918)
    • APC Conjugation Kit - Lightning-Link® (ab201807)
  • Corresponding phospho antibody

    • Anti-c-Jun (phospho S243) antibody (ab28846)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Recombinant Protein

    • Recombinant Human c-Jun protein (ab84134)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab31419 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA
Use at an assay dependent concentration.
ICC/IF
Use a concentration of 1 µg/ml.
IP (2)
Use at an assay dependent concentration.
ChIP (1)
Use at an assay dependent concentration.
Flow Cyt (1)
Use at an assay dependent concentration.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

IHC-P (2)
1/50 - 1/100.
WB (7)
1/500 - 1/1000. Predicted molecular weight: 36 kDa.
Notes
ELISA
Use at an assay dependent concentration.
ICC/IF
Use a concentration of 1 µg/ml.
IP
Use at an assay dependent concentration.
ChIP
Use at an assay dependent concentration.
Flow Cyt
Use at an assay dependent concentration.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

IHC-P
1/50 - 1/100.
WB
1/500 - 1/1000. Predicted molecular weight: 36 kDa.

Target

  • Function

    Transcription factor that recognizes and binds to the enhancer heptamer motif 5'-TGA[CG]TCA-3'. Promotes activity of NR5A1 when phosphorylated by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. Involved in activated KRAS-mediated transcriptional activation of USP28 in colorectal cancer (CRC) cells (PubMed:24623306). Binds to the USP28 promoter in colorectal cancer (CRC) cells (PubMed:24623306).
  • Sequence similarities

    Belongs to the bZIP family. Jun subfamily.
    Contains 1 bZIP (basic-leucine zipper) domain.
  • Post-translational
    modifications

    Ubiquitinated by the SCF(FBXW7), leading to its degradation. Ubiquitination takes place following phosphorylation, that promotes interaction with FBXW7.
    Phosphorylated by CaMK4 and PRKDC; phosphorylation enhances the transcriptional activity. Phosphorylated by HIPK3. Phosphorylated by DYRK2 at Ser-243; this primes the protein for subsequent phosphorylation by GSK3B at Thr-239. Phosphorylated at Thr-239, Ser-243 and Ser-249 by GSK3B; phosphorylation reduces its ability to bind DNA. Phosphorylated by PAK2 at Thr-2, Thr-8, Thr-89, Thr-93 and Thr-286 thereby promoting JUN-mediated cell proliferation and transformation. Phosphorylated by PLK3 following hypoxia or UV irradiation, leading to increase DNA-binding activity.
    Acetylated at Lys-271 by EP300.
  • Cellular localization

    Nucleus.
  • Target information above from: UniProt accession P05412 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 424673 Chicken
    • Entrez Gene: 280831 Cow
    • Entrez Gene: 3725 Human
    • Entrez Gene: 16476 Mouse
    • Entrez Gene: 396913 Pig
    • Entrez Gene: 24516 Rat
    • Omim: 165160 Human
    • SwissProt: P18870 Chicken
    • SwissProt: P05412 Human
    • SwissProt: P05627 Mouse
    • SwissProt: P56432 Pig
    • SwissProt: P17325 Rat
    • Unigene: 696684 Human
    • Unigene: 275071 Mouse
    • Unigene: 93714 Rat
    see all
  • Alternative names

    • Activator protein 1 antibody
    • AP 1 antibody
    • AP-1 antibody
    • AP1 antibody
    • cJun antibody
    • Enhancer Binding Protein AP1 antibody
    • Jun Activation Domain Binding Protein antibody
    • JUN antibody
    • Jun oncogene antibody
    • JUN protein antibody
    • Jun proto oncogene antibody
    • JUN_HUMAN antibody
    • JUNC antibody
    • Oncogene JUN antibody
    • p39 antibody
    • Proto oncogene c jun antibody
    • Proto oncogene cJun antibody
    • Proto-oncogene c-jun antibody
    • Transcription Factor AP 1 antibody
    • Transcription factor AP-1 antibody
    • Transcription Factor AP1 antibody
    • V jun avian sarcoma virus 17 oncogene homolog antibody
    • V jun sarcoma virus 17 oncogene homolog (avian) antibody
    • V jun sarcoma virus 17 oncogene homolog antibody
    • V-jun avian sarcoma virus 17 oncogene homolog antibody
    • vJun Avian Sarcoma Virus 17 Oncogene Homolog antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-c-Jun antibody (ab31419)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-c-Jun antibody (ab31419)

    Paraffin-embedded human breast carcinoma tissue stained for c-Jun with ab31419 at a 1/50 dilution in immunohistochemical analysis.

    Left panel: Untreated.

    Right panel: Pre-incubated with synthesized peptide.

  • Immunocytochemistry/ Immunofluorescence - Anti-c-Jun antibody (ab31419)
    Immunocytochemistry/ Immunofluorescence - Anti-c-Jun antibody (ab31419)

    ICC/IF image of  HepG2 (Human liver hepatocellular carcinoma cell line) cells labeling c-Jun (green) with ab31419 at 1 µg/ml. The cells were fixed in 4% PFA (10 minutes) and then incubated in 1% BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1 hour to permeabilize the cells and block non-specific protein-protein interactions. The cells were then incubated with ab31419 at 1 µg/ml overnight at +4 °C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-rabbit IgG (H+L) ab150077 used at a 1/1000 dilution for 1 hour. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1 hour. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43 µM.

  • Western blot - Anti-c-Jun antibody (ab31419)
    Western blot - Anti-c-Jun antibody (ab31419)
    All lanes : Anti-c-Jun antibody (ab31419) at 1/500 dilution

    Lane 1 : Extracts of Hela (Human epithelial cell line from cervix adenocarcinoma) cells
    Lane 2 : Extracts of Hela (Human epithelial cell line from cervix adenocarcinoma) cells with immunizing peptide

    Predicted band size: 36 kDa
    Observed band size: 43 kDa why is the actual band size different from the predicted?

  • Western blot - Anti-c-Jun antibody (ab31419)
    Western blot - Anti-c-Jun antibody (ab31419)
    Anti-c-Jun antibody (ab31419) at 1/500 dilution + Recombinant Human c-Jun protein (ab54318) at 0.01 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution

    Developed using the ECL technique.

    Performed under reducing conditions.

    Predicted band size: 36 kDa


    Exposure time: 30 seconds

Protocols

  • Immunohistochemistry protocols
  • Immunocytochemistry & immunofluorescence protocols
  • Western blot protocols

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (72)

Publishing research using ab31419? Please let us know so that we can cite the reference in this datasheet.

ab31419 has been referenced in 72 publications.

  • Zhang GQ  et al. Interleukin 6 regulates the expression of programmed cell death ligand 1 in thyroid cancer. Cancer Sci 112:997-1010 (2021). PubMed: 33247999
  • Liang X & Ju J Matrine inhibits ovarian cancer cell viability and promotes apoptosis by regulating the ERK/JNK signaling pathway via p38MAPK. Oncol Rep 45:N/A (2021). PubMed: 33786627
  • Xu X  et al. YAP-TEAD up-regulates IRS2 expression to induce and deteriorate oesophageal cancer. J Cell Mol Med 25:2584-2595 (2021). PubMed: 33570213
  • Chen X  et al. DCBLD2 Mediates Epithelial-Mesenchymal Transition-Induced Metastasis by Cisplatin in Lung Adenocarcinoma. Cancers (Basel) 13:N/A (2021). PubMed: 33808696
  • Li L & Zhao W The mutual regulatory loop between TPTEP1 and miR-1303 in leukemogenesis of acute myeloid leukemia. Cancer Cell Int 21:260 (2021). PubMed: 33985519
View all Publications for this product

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

1-10 of 21 Abreviews or Q&A

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) abreview for Anti-c-Jun antibody - ChIP Grade

Excellent
Abreviews
Abreviews
abreview image
Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Na-citrate pH6
Sample
Mouse Tissue sections (Liver, P5)
Specification
Liver, P5
Permeabilization
Yes - Triton 0,05%
Fixative
Paraformaldehyde
Read More
The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

Abcam user community

Verified customer

Submitted Oct 07 2014

Immunoprecipitation abreview for Anti-c-Jun antibody - ChIP Grade

Excellent
Abreviews
Abreviews
Application
Immunoprecipitation
Immuno-precipitation step
Other - EMSA
Sample
Human Cell lysate - nuclear (renal cancer cells)
Specification
renal cancer cells
Total protein in input
3 µg
Read More
The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

Abcam user community

Verified customer

Submitted Mar 14 2014

ChIP

Excellent
Abreviews
Abreviews
abreview image
Application
ChIP
Detection step
Real-time PCR
Sample
Human Cell lysate - whole cell (EA.hy926 endothelial cells)
Specification
EA.hy926 endothelial cells
Negative control
Igr5 intron 3 contains no c-Jun binding site (Aguilera C et al. Nature. 2011 469: 231-235)
Type
Cross-linking (X-ChIP)
Duration of cross-linking step: 10 minute(s) and 0 second(s)
Specification of the cross-linking agent: formaldehyde (final concentrat
Positive control
Position 89340150-89340297 in chromosome 11 has a validated c-Jun site (ENCODE Project Consortium. PLoS Biol. 2011 9:e1001046
Read More
The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

Abcam user community

Verified customer

Submitted Jun 05 2013

Western blot

Excellent
Abreviews
Abreviews
abreview image
Application
Western blot
Loading amount
30 µg
Gel Running Conditions
Reduced Denaturing (12%)
Sample
Human Cell lysate - whole cell (EA.hy926 endothelial cells)
Specification
EA.hy926 endothelial cells
Treatment
c-Jun siRNA for 48h
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C
Read More
The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

Abcam user community

Verified customer

Submitted Jun 05 2013

Western blot abreview for Anti-c-Jun antibody - ChIP Grade

Good
Abreviews
Abreviews
abreview image
Application
Western blot
Sample
Human Cell lysate - whole cell (HCT116)
Loading amount
30 µg
Specification
HCT116
Gel Running Conditions
Non-reduced Denaturing (12%)
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
Read More
The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

Abcam user community

Verified customer

Submitted Nov 07 2012

Question

Hello , Here is the complain of two antibodies .

1) Abcam catalogue no:

Ab31419, Ab47476

2) a) Abcam order number (not required):

1148646


b) Abcam product lot number:

c-Jun> GR50836-9, ATF-2> GR72060-1

3) Description of the problem (high background, wrong band size, more bands, no band etc):

No bands

4) Antibody storage conditions (temperature/reconstitution etc):

-20°C


5) a)Sample (Species):


c-Jun and ATF2 from HeLa


b) Type of sample (Cell extract/Nuclear extract/Purified protein/Recombinant protein etc).:


Whole cell extract

6) a) Sample preparation:

Lysis buffer



RIPA





Protease inhibitors



AEBSF, 2 mM
Aprotinin, 0.3 μM
Bestatin, 130 μM
EDTA, 1 mM
E-64, 14 μM
Leupeptin, 1 μM

PMSF, 20 mM





Phosphatase inhibitors



-





Reducing agent



SDS and β-ME





Boiling for ≥5 min?



5 minutes







b) Amount of protein loaded:







Protein loaded ug/lane or cells/lane



5 μg/lane







7) a) Electrophoresis/Gel conditions:







Reducing or Non Reducing gel



Reducing





Percentage of gel



15%





Volts applied



75





Time applied



3 hours

















b) Transfer or blocking conditions:







Type of membrane



PVDF





Protein transfer verified



Ponceau, β-actin





Blocking agent and concentration



3% BSA





Blocking time



30 minutes





Blocking temperature



25°C

















8) Primary antibody (If more than one was used, describe in “additional notes”):









Concentration or dilution



1/1000





Diluent buffer



1% BSA + 0.05% Tween-20 in 1X PBS





Incubation time



2 hours





Incubation temperature



25°C





Washing: Buffer Used



0.05% Tween-20 in 1X PBS





Number of washes



3







9) Secondary antibody:









Species



Goat





Reacts against



Rabbit





Concentration or dilution



1/10,000





Diluent buffer



1% BSA + 0.05% Tween-20 in 1X PBS





Incubation time



2 hours





Incubation temperature:



25°C





Fluorochrome or enzyme conjugate



HRP





Washing: Buffer Used



0.05% Tween-20 in 1X PBS





Number of washes



3







10) Detection method (ECL, ECL plus, etc.):









ECL





11) Positive and negative controls used:









Positive control



β-actin





Negative control











12) a) How many times you have run this staining?







Twice







b) Do you obtain the same results every time?







No







C) What steps have you altered to try and optimize the use of this antibody?







Reducing blocking, primary and secondary incubation times while attempting the second time. Washing was made slightly rigorous as compared to he first time. Performed a Dot blot to check for performance of secondary antibody and it works fine. Increased amount of loaded protein to 10 μg/lane.







Regards

Read More

Abcam community

Verified customer

Asked on Dec 18 2012

Answer

Thank you for your enquiry regarding ab31419 and ab47476; and for taking the time to provide some useful details of the experiments. I am very sorry to hear that your customer is having problems with these two antibodies.
I would like to reassure you that our Abpromise applies to your complaint since you purchased this product within the guarantee period. This means that in the event that a product is not functioning in the applications/species cited on the product data sheet (and the problem has been reported within 6 months of purchase) we will happily offer a credit note/refund to the value of the product purchased.
After reading through the detailed protocol you kindly forwarded to Abcam, I would like to make the following comments/suggestions:
1) The loaded amount of protein seems to be a bit low: 5 μg/lane, normally we would suggest loading at least 25-30 μg/lane protein per lane.
2) Since c-Jun and ATF2 are both mainly present in the nuclei, it would be worth preparing nuclear fraction (rather than whole cell lysate) to enrich the target proteins in the sample if it is possible and apply them for WB.
3) Customer may also need to test different dilutions (1/500 or even 1/250) to make sure that the experiment is carried out under the optimal conditions. This is even more important since only 5 μg instead of 30 μg lysate was loaded.
I hope this will be useful for you. Should you still have any problem with this antibody after following these suggestions, then please do not hesitate to contact our Technical Department again.

Read More

Abcam Scientific Support

Answered on Dec 18 2012

Question

Thank you so very much! this is helpful, is there any information in what % of breast ca it is positive, and ductal over lobular variant? txs, I am looking forward to your response!

Read More

Abcam community

Verified customer

Asked on Nov 28 2012

Answer

Thank you for contacting us.

I do wish to aplogize for the delays in getting information about this product to you. I have been informded by the originator of this product that the images are using ductal breast carcinoma however as of this time we do not have any information regarding the percentages of breat carcinoma would be positive.



This product is covered by our Abpromise guarantee. We are happy provide scientific support at any time. If you are using the product in species and applications listed on the datasheet and contact us within six months of purchase, we are also happy to replace or refund the product should we not be able to help you to resolve the issue. More information on our Abpromise may be found at the following link:

https://www.abcam.com/index.html?pageconfig=abpromise

I hope that this information is helpful. Please let me know if you have any questions or there are other ways that Abcam may help you meet your research goals

Free Rabbit monoclonal antibody with any purchase of a primary antibody, while stocks last! Quote “RABMAB-XBSMG” in your next primary antibody order. For more information, visit the following link: https://www.abcam.com/index.html?pageconfig=resource&rid=15447

Read More

Abcam Scientific Support

Answered on Nov 28 2012

Question

Dear Ladies and Gentlemen, I just purchased ab31419, in your datasheet you show a paraffin section of "human breast carcinoma" tissue, I am trying to setup controls, to see if the antibody is working in my conditions: 1) is it ductal or lobular breast carcinoma and is it metastatic? so I get the correct controls 2) do you have information in which other epithelial tissues or cancer tissues this antibody is working? lung, skin, stomach, esophagus, sarkomas, other cancers I am looking very much forward to your response best regards

Read More

Abcam community

Verified customer

Asked on Nov 12 2012

Answer

Thank you very much for contacting us.

I just wanted to let you know that I am still working on your inquiry. I have contacted the originator of this product for the information you requested, and I am awaiting a reply.

I can provide some information regarding postive controls for this product. This antibody has been tested successfully in the following tissues/cell lines as shown in on the datasheet and within publicatiobns referenced:

Hela, Jurkat, Mouse small bowel adenoma, U2OS, 3T3, COS7, PC12 , Primary Prostate Epithelia [PMID: 19592505], dorsal mouse skin [PMID: 19762425]


I am very sorry for the delay. I will forward to you the information as soon as I receive it. Thank you for your patience.

Read More

Abcam Scientific Support

Answered on Nov 12 2012

Question

Thanks for your fast answer, I would maybe preffer to try a different
antibody. For my experiments, I also need an antibody afainst c-Fos for
ChIP, dou you have one? The oligo was ordered on 12th october 2011 and we
got it one day later. for the ChIP I´ve tried using 2.5 and 5ug of antibody
and in the WB I´ve used dilution 1/500.

Read More

Abcam community

Verified customer

Asked on Feb 02 2012

Answer

Thank you for your reply.

Unfortunately we do not have another C-Jun antibody that is tested in ChIP. Please let me know how you would like to proceed. We do not currently stock a C-Fos antibody that will work in ChIP but if you would like to test an antibody then please let me know. You may be eligible for a testing discount.

I look forward to your reply.

Read More

Abcam Scientific Support

Answered on Feb 02 2012

Question

The antibody is not working in WB and ChIP

Read More

Abcam community

Verified customer

Asked on Feb 01 2012

Answer

Thank you for your reply and with clarifying information.

We have not received any other complaints about this antibody, so I am sorry to hear you have been experiencing problems. It is troubling that it is not working in both ChIP and WB. I would like to offer you a replacement vial of the same or an alternative product, or a refund/credit. Please could you confirm your preference and also provide the following details:

- Date of order/delivery
- Primary antibody dilution

I look forward to your reply.

Read More

Abcam Scientific Support

Answered on Feb 01 2012

1-10 of 21 Abreviews or Q&A

  •  Previous
  • 1
  • 2
  • 3
  • Next 

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2023 Abcam plc. All rights reserved.