Anti-c-Jun antibody (ab31419)
Key features and details
- Rabbit polyclonal to c-Jun
- Suitable for: ELISA, ICC/IF, IP, ChIP, Flow Cyt, IHC-P, WB
- Reacts with: Mouse, Rat, Human, African green monkey
- Isotype: IgG
Get better batch-to-batch reproducibility with a recombinant antibody
- Research with confidence – consistent and reproducible results with every batch
- Long-term and scalable supply – powered by recombinant technology for fast production
- Success from the first experiment – confirmed specificity through extensive validation
- Ethical standards compliant – production is animal-free
Overview
-
Product name
Anti-c-Jun antibody
See all c-Jun primary antibodies -
Description
Rabbit polyclonal to c-Jun -
Host species
Rabbit -
Specificity
Antibody detects endogenous levels of c-Jun protein around Serine 243. -
Tested applications
Suitable for: ELISA, ICC/IF, IP, ChIP, Flow Cyt, IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Rat, Human, African green monkey
Predicted to work with: Chicken, Cow, Pig -
Immunogen
Synthetic peptide within Human c-Jun aa 210-259. The exact sequence is proprietary.
Sequence:HLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKR
Database link: P05412 -
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol, 0.87% Sodium chloride
Without Mg2+ and Ca2+ -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Assay kits
-
ChIP Related Products
-
Compatible Secondaries
-
Conjugation kits
-
Corresponding phospho antibody
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab31419 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ELISA |
Use at an assay dependent concentration.
|
|
ICC/IF |
Use a concentration of 1 µg/ml.
|
|
IP | (2) |
Use at an assay dependent concentration.
|
ChIP | (1) |
Use at an assay dependent concentration.
|
Flow Cyt | (1) |
Use at an assay dependent concentration.
ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
IHC-P | (2) |
1/50 - 1/100.
|
WB | (7) |
1/500 - 1/1000. Predicted molecular weight: 36 kDa.
|
Notes |
---|
ELISA
Use at an assay dependent concentration. |
ICC/IF
Use a concentration of 1 µg/ml. |
IP
Use at an assay dependent concentration. |
ChIP
Use at an assay dependent concentration. |
Flow Cyt
Use at an assay dependent concentration. ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
IHC-P
1/50 - 1/100. |
WB
1/500 - 1/1000. Predicted molecular weight: 36 kDa. |
Target
-
Function
Transcription factor that recognizes and binds to the enhancer heptamer motif 5'-TGA[CG]TCA-3'. Promotes activity of NR5A1 when phosphorylated by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. Involved in activated KRAS-mediated transcriptional activation of USP28 in colorectal cancer (CRC) cells (PubMed:24623306). Binds to the USP28 promoter in colorectal cancer (CRC) cells (PubMed:24623306). -
Sequence similarities
Belongs to the bZIP family. Jun subfamily.
Contains 1 bZIP (basic-leucine zipper) domain. -
Post-translational
modificationsUbiquitinated by the SCF(FBXW7), leading to its degradation. Ubiquitination takes place following phosphorylation, that promotes interaction with FBXW7.
Phosphorylated by CaMK4 and PRKDC; phosphorylation enhances the transcriptional activity. Phosphorylated by HIPK3. Phosphorylated by DYRK2 at Ser-243; this primes the protein for subsequent phosphorylation by GSK3B at Thr-239. Phosphorylated at Thr-239, Ser-243 and Ser-249 by GSK3B; phosphorylation reduces its ability to bind DNA. Phosphorylated by PAK2 at Thr-2, Thr-8, Thr-89, Thr-93 and Thr-286 thereby promoting JUN-mediated cell proliferation and transformation. Phosphorylated by PLK3 following hypoxia or UV irradiation, leading to increase DNA-binding activity.
Acetylated at Lys-271 by EP300. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 424673 Chicken
- Entrez Gene: 280831 Cow
- Entrez Gene: 3725 Human
- Entrez Gene: 16476 Mouse
- Entrez Gene: 396913 Pig
- Entrez Gene: 24516 Rat
- Omim: 165160 Human
- SwissProt: P18870 Chicken
see all -
Alternative names
- Activator protein 1 antibody
- AP 1 antibody
- AP-1 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-c-Jun antibody (ab31419)
Paraffin-embedded human breast carcinoma tissue stained for c-Jun with ab31419 at a 1/50 dilution in immunohistochemical analysis.
Left panel: Untreated.
Right panel: Pre-incubated with synthesized peptide.
-
ICC/IF image of HepG2 (Human liver hepatocellular carcinoma cell line) cells labeling c-Jun (green) with ab31419 at 1 µg/ml. The cells were fixed in 4% PFA (10 minutes) and then incubated in 1% BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1 hour to permeabilize the cells and block non-specific protein-protein interactions. The cells were then incubated with ab31419 at 1 µg/ml overnight at +4 °C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-rabbit IgG (H+L) ab150077 used at a 1/1000 dilution for 1 hour. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1 hour. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43 µM.
-
All lanes : Anti-c-Jun antibody (ab31419) at 1/500 dilution
Lane 1 : Extracts of Hela (Human epithelial cell line from cervix adenocarcinoma) cells
Lane 2 : Extracts of Hela (Human epithelial cell line from cervix adenocarcinoma) cells with immunizing peptide
Predicted band size: 36 kDa
Observed band size: 43 kDa why is the actual band size different from the predicted? -
Anti-c-Jun antibody (ab31419) at 1/500 dilution + Recombinant Human c-Jun protein (ab54318) at 0.01 µg
Secondary
Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution
Developed using the ECL technique.
Performed under reducing conditions.
Predicted band size: 36 kDa
Exposure time: 30 seconds
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (72)
ab31419 has been referenced in 72 publications.
- Zhang GQ et al. Interleukin 6 regulates the expression of programmed cell death ligand 1 in thyroid cancer. Cancer Sci 112:997-1010 (2021). PubMed: 33247999
- Liang X & Ju J Matrine inhibits ovarian cancer cell viability and promotes apoptosis by regulating the ERK/JNK signaling pathway via p38MAPK. Oncol Rep 45:N/A (2021). PubMed: 33786627
- Xu X et al. YAP-TEAD up-regulates IRS2 expression to induce and deteriorate oesophageal cancer. J Cell Mol Med 25:2584-2595 (2021). PubMed: 33570213
- Chen X et al. DCBLD2 Mediates Epithelial-Mesenchymal Transition-Induced Metastasis by Cisplatin in Lung Adenocarcinoma. Cancers (Basel) 13:N/A (2021). PubMed: 33808696
- Li L & Zhao W The mutual regulatory loop between TPTEP1 and miR-1303 in leukemogenesis of acute myeloid leukemia. Cancer Cell Int 21:260 (2021). PubMed: 33985519