Overview

  • Product name

    Anti-C Reactive Protein antibody
    See all C Reactive Protein primary antibodies
  • Description

    Rabbit polyclonal to C Reactive Protein
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Guinea pig
  • Immunogen

    Recombinant full length protein corresponding to Guinea pig C Reactive Protein aa 20-225. His-tag and S-tag. Full length mature chain, expressed in E. coli.
    Sequence:

    MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGS GTDMSKKTFVFPKETDNSYVSLKAQLKKPLSAFTVCLHIYTELFMTRGYS IFSYATEKEANEILIFWSKDRGYILGVGGIEMPFKAPEIPSAPVHICTSW ESVSGIIELWVDGKAQVRKSLQKGYFVGTEAMIILGQDQDSFGGSFDANQ SFVGDIGDVNMWDFVLSPKEIDMVYSGGTFSPNVLSWRSLTYETHGEVFI KPQLWP


    Database link: P49254

  • Positive control

    • WB: Recombinant Guinea pig C Reactive Protein; rat serum.

Properties

Applications

Our Abpromise guarantee covers the use of ab230984 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 25 kDa.

Target

  • Function

    Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells.
  • Tissue specificity

    Found in plasma.
  • Sequence similarities

    Belongs to the pentaxin family.
    Contains 1 pentaxin domain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Pentraxin 1, short antibody
    • C reactive protein antibody
    • C reactive protein pentraxin related antibody
    • C-reactive protein(1-205) antibody
    • CRP antibody
    • CRP_HUMAN antibody
    • MGC88244 antibody
    • Pentraxin 1 antibody
    • PTX 1 antibody
    • PTX1 antibody
    see all

Images

  • Anti-C Reactive Protein antibody (ab230984) at 2 µg/ml + Recombinant Guinea pig C Reactive Protein

    Developed using the ECL technique.

    Predicted band size: 25 kDa

  • Anti-C Reactive Protein antibody (ab230984) at 2 µg/ml + Rat serum

    Developed using the ECL technique.

    Predicted band size: 25 kDa

References

ab230984 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230984.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up