Anti-C Reactive Protein antibody (ab231022)
Key features and details
- Rabbit polyclonal to C Reactive Protein
- Suitable for: WB
- Reacts with: Rat, Cow
- Isotype: IgG
Overview
-
Product name
Anti-C Reactive Protein antibody
See all C Reactive Protein primary antibodies -
Description
Rabbit polyclonal to C Reactive Protein -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Rat, Cow -
Immunogen
Recombinant full length protein (His-tag) corresponding to Cow C Reactive Protein aa 14-224. Expressed in E. coli. His-tag and T7-tag.
Sequence:MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSFSSVSGQTDLHKKAFV FPKETENSYVSLKTQLRTPLKAFTVCLYFYTELARTHSYSIFSYATKQQP NEILIFWSKGKGYIFGVHGKQVLFQSPENTQAPTHICASWESTSGIAELW VNGKPRMRKSLEKGAILGTEASIILGQEQDAFAGGFDRNQCLVGDIGDVN MWDFVLSPEEINAVYLGSTLSPNVLNWQALNYEAKGEVFIKPQLW
Database link: C4T8B4 -
Positive control
- WB: Cow serum; cow and rat liver lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231022 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 25 kDa. |
Target
-
Function
Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. -
Tissue specificity
Found in plasma. -
Sequence similarities
Belongs to the pentaxin family.
Contains 1 pentaxin domain. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 25419 Rat
- SwissProt: P48199 Rat
- Unigene: 16463 Rat
-
Alternative names
- Pentraxin 1, short antibody
- C reactive protein antibody
- C reactive protein pentraxin related antibody
see all
Images
-
Anti-C Reactive Protein antibody (ab231022) at 3 µg/ml + Rat liver lysate
Predicted band size: 25 kDa -
Anti-C Reactive Protein antibody (ab231022) at 3 µg/ml + Cow liver lysate
Predicted band size: 25 kDa -
Anti-C Reactive Protein antibody (ab231022) at 3 µg/ml + Cow serum
Predicted band size: 25 kDa -
Anti-C Reactive Protein antibody (ab231022) at 3 µg/ml + Recombinant cow C Reactive Protein
Predicted band size: 25 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231022 has not yet been referenced specifically in any publications.