Overview

  • Product name

  • Description

    Rabbit polyclonal to C10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Rat C10 aa 21-115. N-terminal tags. Full length mature chain, expressed in E.coli.
    Sequence:

    AGLIQDTVKEDRPFNPTIIHQGFQDSSDCCFSYASQIPCSRFIYYFPTSG GCTKPGIIFVTRKRKRVCANPSDQRVQTCISTLKLGPRSGNSAIA


    Database link: Q68FP3

  • Positive control

    • IHC-P: Rat testis, spleen, liver and lung tissues. WB: HeLa cell lysate; Recombinant rat C10 protein.
  • General notes

    Protein target previously labeled as CCL6.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231609 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231609 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 13 kDa.

Target

  • Relevance

    CCL6 (C10) is a small cytokine belonging to the CC chemokine family that has only been identified in rodents. It is a potent chemoattractant of macrophages, but it can also attract B cells, CD4+ lymphocytes and eosinophils. In mice, CCL6 is expressed in cells from neutrophil and macrophage lineages, and can be induced under conditions suitable for myeloid cell differentiation. CCL6 (C10) was originally identified as a transcript that is induced in bone marrow cells upon stimulation of GMCSF. The cell surface receptor for CCL6 is believed to be the chemokine receptor CCR1.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • C10 antibody
    • CCL 6 antibody
    • chemokine (C-C motif) ligand 6 antibody
    • Chemokine C C motif Ligand 6 antibody
    • MRP1 antibody
    • SCYA6 antibody
    • Small Inducible Cytokine A6 antibody
    see all

Images

  • Anti-C10 antibody (ab231609) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 13 kDa

  • Paraffin-embedded rat testis tissue stained for C10 using ab231609 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat spleen tissue stained for C10 using ab231609 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat liver tissue stained for C10 using ab231609 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat lung tissue stained for C10 using ab231609 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-C10 antibody (ab231609) at 2 µg/ml + Recombinant rat C10 protein

    Predicted band size: 13 kDa

References

ab231609 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231609.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up