Overview

  • Product name

    Anti-C10orf46/CAC1 antibody
    See all C10orf46/CAC1 primary antibodies
  • Description

    Rabbit polyclonal to C10orf46/CAC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human C10orf46/CAC1 aa 220-270 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    ALQSIVPLFIYMNKFYIETKLNRDLKDDLIKLFTEHVAEKHIYSLMPLLL E


    Database link: Q86Y37

  • Positive control

    • IHC-P: Human lung carcinoma tissue.
  • General notes

     This product was previously labelled as C10orf46

     

Properties

Applications

Our Abpromise guarantee covers the use of ab215168 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Relevance

    Belongs to the cullin family. There are 3 isoforms.
  • Database links

  • Alternative names

    • Chromosome 10 open reading frame 46 antibody
    • Cullin antibody
    • FLJ40409 antibody
    • MGC33215 antibody
    • OTTHUMP00000046870 antibody
    • Uncharacterized protein C10orf46 homolog antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human lung carcinoma tissue labeling C10orf46/CAC1 with ab215168 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

References

ab215168 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215168.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up