Anti-C10orf54 antibody [CL3975] (ab219829)

Overview

  • Product name

    Anti-C10orf54 antibody [CL3975]
    See all C10orf54 primary antibodies
  • Description

    Mouse monoclonal [CL3975] to C10orf54
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human C10orf54 aa 92-185.
    Sequence:

    LTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDS GLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSS


    Database link: Q9H7M9

  • Positive control

    • Human placenta, liver, lymph node, rectum and cerebral cortex tissues; CAPAN2 cell lysate.
  • General notes

    Binds to an epitope located within the peptide sequence DLAQRHGLES as determined by overlapping synthetic peptides.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    CL3975
  • Isotype

    IgG1

Applications

Our Abpromise guarantee covers the use of ab219829 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/1000. Predicted molecular weight: 34 kDa.

Target

  • Relevance

    Function: Immunoregulatory receptor which inhibits the T-cell response (PubMed:24691993). May promote differentiation of embryonic stem cells, by inhibiting BMP4 signaling (By similarity). May stimulate MMP14-mediated MMP2 activation (PubMed:20666777). Tissue specificity: Expressed in spleen. Detected on a number of myeloid cells including CD11b monocytes, CD66b+ neutrophils, at low levels on CD4+ and CD8+ T-cells, and in a subset of NK cells. Not detected on B cells (at protein level). Expressed at high levels in placenta, spleen, plasma blood leukocytes, and lung. Expressed at moderate levels in lymph node, bone marrow, fat, uterus, and trachea. Has low expression levels in other tissues. Similarity: Contains 1 Ig-like V-type (immunoglobulin-like) domain. PTM: At the cell surface, may be cleaved by MMP14. N-glycosylated.
  • Database links

  • Alternative names

    • C10orf54 antibody
    • Platelet receptor Gi24 antibody
    • Sisp-1 antibody
    • Stress-induced secreted protein-1 antibody
    • V-set domain-containing immunoregulatory receptor antibody
    • V-type immunoglobulin domain-containing suppressor of T-cell activation antibody
    • VISTA_HUMAN antibody
    see all

Images

  • Anti-C10orf54 antibody [CL3975] (ab219829) at 1/500 dilution + CAPAN2 cell lysate

    Predicted band size: 34 kDa

  • Immunohistochemical analysis of paraffin-embedded human placenta tissue labeling C10orf54 with ab219829 at 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded human rectum tissue labeling C10orf54 with ab219829 at 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded human liver tissue labeling C10orf54 with ab219829 at 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded human cerebral cortex tissue labeling C10orf54 with ab219829 at 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded human lymph node tissue labeling C10orf54 with ab219829 at 1/200 dilution.

References

ab219829 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219829.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up