Overview

  • Product name

    Anti-C10orf67 antibody
  • Description

    Rabbit polyclonal to C10orf67
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment within Human C10orf67 aa 222-304. The exact sequence is proprietary.
    Sequence:

    EELDQYKDFGFHKMESFAKETSSPKSNLEKENLEYKVENERLLQIISELE EEIQINLKENSGLEDELISMKEMAEKDHKTIQK


    Database link: Q8IYJ2

  • Positive control

    • ICC/IF: HaCaT cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220601 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    The function of C10orf67 is unknown.
  • Database links

  • Alternative names

    • Chromosome 10 open reading frame 67 antibody
    • Hypothetical protein LOC256815 antibody
    • Uncharacterized protein C10orf67 antibody

Images

  • Immunofluorescent analysis of HaCaT cells labeling C10orf67 with ab220601 at 4 µg/mL (green).

References

ab220601 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220601.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up