Overview

  • Product name

    Anti-C11ORF54 antibody
  • Description

    Rabbit polyclonal to C11ORF54
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human C11ORF54 aa 104-183.
    Sequence:

    TLGFNSEFMPVIQTESEHKPPVNGSYFAHVNPADGGCLLEKYSEKCHDFQ CALLANLFASEGQPGKVIEVKAKRRTGPLN


    Database link: Q9H0W9

  • Positive control

    • IHC-P: Human kidney tissue. WB: Human liver tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab224558 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 35 kDa.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    C11ORF54 exhibits ester hydrolase activity on the substrate p-nitrophenyl acetate.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • Chromosome 11 open reading frame 54 antibody
    • Ester hydrolase C11orf54 antibody
    • Hypothetical protein LOC28970 antibody
    • LP4947 antibody
    • PTD012 antibody
    • PTOD012 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for C11ORF54 using ab224558 at 1/1000 dilution in immunohistochemical analysis.

  • All lanes : Anti-C11ORF54 antibody (ab224558) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate
    Lane 3 : Human plasma (IgG/HSA depleted)
    Lane 4 : Human liver tissue lysate

    Developed using the ECL technique.

    Predicted band size: 35 kDa

References

ab224558 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224558.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up