Overview

  • Product name

  • Description

    Rabbit polyclonal to C11orf79
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human C11orf79 aa 22-86.
    Sequence:

    LSPLLSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTDESIETKRARLL YESRKRGMLENCILL


    Database link: Q9NX18

  • Positive control

    • IHC-P: Human colon tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab243818 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Required for insertion of FAD cofactor into SDHA, the catalytic subunit of succinate dehydrogenase (SDH). SDH is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). In is unclear whether it participates in the chemistry of FAD attachment (enzymatic function) or acts as a chaperone that maintains SDHA in a conformation that is susceptible to autocatalytic FAD attachment.
  • Involvement in disease

    Defects in SDHAF2 are the cause of hereditary paragangliomas type 2 (PGL2) [MIM:601650]; also known as familial non-chromaffin paragangliomas type 2. Paragangliomas refer to rare and mostly benign tumors that arise from any component of the neuroendocrine system. PGL2 is characterized by the development of non-chromaffin paragangliomas of the head and neck. There is a fairly equal distribution of different locations in the head and neck, with the most common location at the carotid body, and a tendency toward tumor multiplicity.
  • Sequence similarities

    Belongs to the SDHAF2 family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • Chromosome 11 open reading frame 79 antibody
    • FLJ20487 antibody
    • hSDH5 antibody
    • mitochondrial antibody
    • Paraganglioma or familial glomus tumors 2 antibody
    • PGL2 antibody
    • SDH assembly factor 2 antibody
    • SDH5 antibody
    • Sdhaf2 antibody
    • SDHF2_HUMAN antibody
    • Succinate dehydrogenase assembly factor 2, mitochondrial antibody
    • Succinate dehydrogenase subunit 5 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human colon tissue stained for C11orf79 with ab243818 at a 1/50 dilution in immunohistochemical analysis.

References

ab243818 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243818.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up