
  • Product name

  • Description

    Rabbit polyclonal to C12orf23
  • Host species

  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    antigen sequence: QQEIPSYLNDEPPEGSMKDHPQQQPGMLSR, corresponding to N terminal amino acids 8-37 of Human C12orf23.

  • Positive control

    • Human pancreas tissue.


  • Form

  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

  • Isotype

  • Research areas


Our Abpromise guarantee covers the use of ab122784 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment



  • Immunofluorescent staining of Human cell line U-2 OS shows positivity in mitochondria. Recommended concentration of ab122784 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • ab122784, at 1/50 dilution, staining C12orf23 in Paraffin Embedded Human pancreas tissue by Immunohistochemistry.


ab122784 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab122784.
Please use the links above to contact us or submit feedback about this product.

For licensing inquiries, please contact partnerships@abcam.com

Sign up