Overview

  • Product name

  • Description

    Rabbit polyclonal to C12orf65
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human C12orf65 aa 36-166. Full length mature chain, without signal peptide.
    Sequence:

    IAVTPVQMAGKKDYPALLSLDENELEEQFVKGHGPGGQATNKTSNCVVLK HIPSGIVVKCHQTRSVDQNRKLARKILQEKVDVFYNGENSPVHKEKREAA KKKQERKKRAKETLEKKKLLKELWESSKKVH


    Database link: Q9H3J6-1

  • Positive control

    • IHC-P: Human colon cancer and kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab234765 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    May act as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion.
  • Involvement in disease

    Defects in C12orf65 are the cause of combined oxidative phosphorylation deficiency type 7 (COXPD7) [MIM:613559]. A mitochondrial disease resulting in encephalomyopathy. Clinical manifestations include psychomotor delay and regression, ataxia, optic atrophy, nystagmus and muscle atrophy and weakness.
  • Sequence similarities

    Belongs to the prokaryotic/mitochondrial release factor family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • C12orf65 antibody
    • chromosome 12 open reading frame 65 antibody
    • CL065_HUMAN antibody
    • COXPD7 antibody
    • mitochondrial antibody
    • Probable peptide chain release factor C12orf65 antibody
    • probable peptide chain release factor C12orf65, mitochondrial antibody
    • SPG55 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for C12orf65 using ab234765 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon cancer tissue stained for C12orf65 using ab234765 at 1/100 dilution in immunohistochemical analysis.

References

ab234765 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234765.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up