Overview

  • Product name
  • Description
    Rabbit polyclonal to C14orf130
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
    Unsuitable for: IP
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Cow, Cat, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan
  • Immunogen

    Synthetic peptide within Human C14orf130 aa 150-200. The exact sequence is proprietary. (NP_786924.2).
    Sequence:

    DEMIQCVVCEDWFHGRHLGAIPPESGDFQEMVCQACMKRCSFLWAYAAQL A


    Database link: Q8N806

  • Positive control
    • 293T, HeLa and Jurkat whole cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab177516 was affinity purified using an epitope specific to C14orf130 immobilized on solid support.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab177516 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 48 kDa.
  • Application notes
    Is unsuitable for IP.
  • Target

    Images

    • All lanes : Anti-C14orf130 antibody (ab177516) at 0.1 µg/ml

      Lane 1 : 293T whole cell lysate
      Lane 2 : HeLa whole cell lysate
      Lane 3 : Jurkat whole cell lysate

      Lysates/proteins at 50 µg per lane.

      Developed using the ECL technique.

      Predicted band size: 48 kDa


      Exposure time: 30 seconds

    References

    ab177516 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab177516.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up