Overview

  • Product name

    Anti-C14orf149 antibody
  • Description

    Rabbit polyclonal to C14orf149
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human C14orf149 aa 13-312.
    Sequence:

    HDPGTPVLSVVDMHTGGEPLRIVLAGCPEVSGPTLLAKRRYMRQHLDHVR RRLMFEPRGHRDMYGAVLVPSELPDAHLGVLFLHNEGYSSMCGHAVLALG RFALDFGLVPAPPAGTREARVNIHCPCGLVTAFVACEDGRSHGPVRFHSV PAFVLATDLMVDVPGHGKVMVDIAYGGAFYAFVTAEKLGLDICSAKTRDL VDAASAVTEAVKAQFKINHPDSEDLAFLYGTILTDGKDAYTKEPTTNICV FADEQVDRSPTGSGVTARIALQYHKGLLELNQMRAFKSSATGSVFTGKAV


    Database link: Q96EM0

  • Positive control

    • IHC-P: Human kidney and lung cancer tissues.
  • General notes

     This product was previously labelled as L3HYPDH

     

Properties

Applications

Our Abpromise guarantee covers the use of ab235399 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human kidney tissue stained for C14orf149 using ab235399 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lung cancer tissue stained for C14orf149 using ab235399 at 1/100 dilution in immunohistochemical analysis.

References

ab235399 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235399.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up