Overview

  • Product name

  • Description

    Rabbit polyclonal to C14orf166
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human C14orf166 aa 1-244.
    Sequence:

    MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRN IHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYK DLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYL VMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEA AQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR


    Database link: Q9Y224

  • Positive control

    • IHC-P: Human liver and kidney tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab238838 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Tissue specificity

    Widely expressed. Expressed at high level in heart and skeletal muscle. Expressed at intermediate level in liver, pancreas, fetal brain and fetal lung. Weakly expressed in adult brain, adult lung, placenta, fetal liver and fetal kidney. Overexpressed in many brain tumors.
  • Sequence similarities

    Belongs to the UPF0568 family.
  • Cellular localization

    Nucleus. Cytoplasm > perinuclear region. Cytoplasm > cytoskeleton > centrosome. May localize at the centrosome during mitosis.
  • Information by UniProt
  • Database links

  • Alternative names

    • C14orf166 antibody
    • CGI 99 antibody
    • CGI-99 antibody
    • CGI99 antibody
    • Chromosome 14 open reading frame 166 antibody
    • CLE antibody
    • CLE7 antibody
    • CN166_HUMAN antibody
    • Homeobox prox 1 antibody
    • LCRP369 antibody
    • RLL motif containing 1 antibody
    • RLLM1 antibody
    • UPF0568 protein C14orf166 antibody
    see all

Images

  • Paraffin-embedded human liver tissue stained for C14orf166 using ab238838 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for C14orf166 using ab238838 at 1/100 dilution in immunohistochemical analysis.

References

ab238838 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238838.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up