Overview

  • Product name

  • Description

    Rabbit polyclonal to C14orf2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISA, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human C14orf2 aa 1-58.
    Sequence:

    MLQSIIKNIWIPMKPYYTKVYQEIWIGMGLMGFIVYKIRAADKRSKALKA SAPAPGHH


    Database link: P56378

  • Positive control

    • WB: EC109 and 293T whole cell lysates. IHC-P: Human placenta tissue. ICC/IF: MCF7 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab193132 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 7 kDa.
ELISA Use at an assay dependent concentration.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

Images

  • All lanes : Anti-C14orf2 antibody (ab193132) at 2 µg/ml

    Lane 1 : EC109 whole cell lysate
    Lane 2 : 293T whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/15000 dilution

    Predicted band size: 7 kDa

  • Immunohistochemical analysis of paraffin-embedded Human placenta tissue labeling C14orf2 with ab193132 at 1/100 dilution.

  • Immunocytochemistry/Immunofluorescence analysis of MCF7 cells labelling C14orf2 with ab193132 at a dilution of 1/100. An Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L) was used as the secondary antibody.

References

ab193132 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193132.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up