Overview

  • Product name

    Anti-C15orf33 antibody
  • Description

    Rabbit polyclonal to C15orf33
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human C15orf33 aa 262-365.
    Sequence:

    TFHEAFPESSYLFNDEFKEDLGNNIFLWCSGLKPQKGFWIHWKLKELSTT TIHGSKKAPAKSVKERIADSQEHISTSIDFNIIKILNNPRAYTLPISKEE SRLS


    Database link: Q96M60

  • Positive control

    • Human plasma; SH SY5Y cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab220982 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

WB 1/100 - 1/250. Predicted molecular weight: 60 kDa.

Target

Images

  • All lanes : Anti-C15orf33 antibody (ab220982) at 1/100 dilution

    Lane 1 : RT4 cell line lysate
    Lane 2 : U251 MG cell line lysate
    Lane 3 : Human plasma

    Predicted band size: 60 kDa

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized SH SY5Y cells labeling C15orf33 with ab220982 at 4 µg/ml (green).

References

ab220982 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220982.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up