Anti-C16orf48 antibody (ab224561)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-C16orf48 antibody
See all C16orf48 primary antibodies -
Description
Rabbit polyclonal to C16orf48 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cow -
Immunogen
Recombinant fragment corresponding to Human C16orf48 aa 221-291.
Sequence:QVLAQVLEQQRQAQEHYNATQKGHVPHYLLERRDLWRREAEARKQSQPDP AMPPGHTRMPENQRLETLTKL
Database link: Q9H0I2 -
Positive control
- IHC-P: Human testis tissue. WB: C16orf48 overexpression HEK-293T cell lysate. ICC/IF: A431 cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab224561 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
WB | 1/100 - 1/250. Predicted molecular weight: 38 kDa. | |
ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Sequence similarities
Contains 1 enkurin domain. - Information by UniProt
-
Database links
- Entrez Gene: 524652 Cow
- Entrez Gene: 84080 Human
- SwissProt: Q3T078 Cow
- SwissProt: Q9H0I2 Human
- Unigene: 729159 Human
-
Alternative names
- Chromosome 16 open reading frame 48 antibody
- DAKV6410 antibody
- DKFZp434A1319 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-C16orf48 antibody (ab224561)
Paraffin-embedded human testis tissue stained for C16orf48 using ab224561 at 1/200 dilution in immunohistochemical analysis.
-
All lanes : Anti-C16orf48 antibody (ab224561) at 1/100 dilution
Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
Lane 2 : C16orf48 overexpression HEK-293T cell lysate (Co-expressed with a C-terminal myc-DDK tag, ~3.1 kDa)
Developed using the ECL technique.
Predicted band size: 38 kDa -
PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for C16orf48 (green) using ab224561 at 4 µg/ml in ICC/IF.
Datasheets and documents
References
ab224561 has not yet been referenced specifically in any publications.