Anti-C16orf48 antibody (ab224561)
Key features and details
- Rabbit polyclonal to C16orf48
- Suitable for: IHC-P, WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-C16orf48 antibody
See all C16orf48 primary antibodies -
Description
Rabbit polyclonal to C16orf48 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cow
-
Immunogen
Recombinant fragment corresponding to Human C16orf48 aa 221-291.
Sequence:QVLAQVLEQQRQAQEHYNATQKGHVPHYLLERRDLWRREAEARKQSQPDP AMPPGHTRMPENQRLETLTKL
Database link: Q9H0I2 -
Positive control
- IHC-P: Human testis tissue. WB: C16orf48 overexpression HEK-293T cell lysate. ICC/IF: A431 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab224561 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 38 kDa. | |
| ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Sequence similarities
Contains 1 enkurin domain. - Information by UniProt
-
Database links
- Entrez Gene: 524652 Cow
- Entrez Gene: 84080 Human
- SwissProt: Q3T078 Cow
- SwissProt: Q9H0I2 Human
- Unigene: 729159 Human
-
Alternative names
- Chromosome 16 open reading frame 48 antibody
- DAKV6410 antibody
- DKFZp434A1319 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-C16orf48 antibody (ab224561)Paraffin-embedded human testis tissue stained for C16orf48 using ab224561 at 1/200 dilution in immunohistochemical analysis.
-
Western blot - Anti-C16orf48 antibody (ab224561)All lanes : Anti-C16orf48 antibody (ab224561) at 1/100 dilution
Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
Lane 2 : C16orf48 overexpression HEK-293T cell lysate (Co-expressed with a C-terminal myc-DDK tag, ~3.1 kDa)
Developed using the ECL technique.
Predicted band size: 38 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-C16orf48 antibody (ab224561)PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for C16orf48 (green) using ab224561 at 4 µg/ml in ICC/IF.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab224561 has not yet been referenced specifically in any publications.
