Anti-C16orf48 antibody (ab235343)
Key features and details
- Rabbit polyclonal to C16orf48
- Suitable for: IHC-P, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-C16orf48 antibody
See all C16orf48 primary antibodies -
Description
Rabbit polyclonal to C16orf48 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant full length protein corresponding to Human C16orf48 aa 1-364.
Sequence:MCEGPSRISGPIPPDPTLCPDNYRRPTSAQGRLEGNALKLDLLTSDRALD TTAPRGPCIGPGAGEILERGQRGVGDVLLQLEGISLGPGASLKRKDPKDH EKENLRRIREIQKRFREQERSREQGQPRPLKALWRSPKYDKVESRVKAQL QEPGPASGTESAHFLRAHSRCGPGLPPPHVSSPQPTPPGPEAKEPGLGVD FIRHNARAAKRAPRRHSCSLQVLAQVLEQQRQAQEHYNATQKGHVPHYLL ERRDLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKLLQSQSQLLR ELVLLPAGADSLRAQSHRAELDRKLVQVEEAIKIFSRPKVFVKMDD
Database link: Q9H0I2-1 -
Positive control
- WB: Mouse brain tissue lysate. IHC-P: Human placenta and testis tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab235343 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. | |
WB | 1/500 - 1/2000. Predicted molecular weight: 39 kDa. |
Target
-
Sequence similarities
Contains 1 enkurin domain. - Information by UniProt
-
Database links
- Entrez Gene: 84080 Human
- Entrez Gene: 102124 Mouse
- SwissProt: Q9H0I2 Human
- SwissProt: Q7TSV9 Mouse
- Unigene: 729159 Human
- Unigene: 276087 Mouse
-
Alternative names
- Chromosome 16 open reading frame 48 antibody
- DAKV6410 antibody
- DKFZp434A1319 antibody
see all
Images
-
Anti-C16orf48 antibody (ab235343) at 1/500 dilution + Mouse brain tissue lysate
Secondary
Goat polyclonal to rabbit at 1/10000 dilution
Predicted band size: 39 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-C16orf48 antibody (ab235343)
Paraffin-embedded human placenta tissue stained for C16orf48 with ab235343 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-C16orf48 antibody (ab235343)
Paraffin-embedded human testis tissue stained for C16orf48 with ab235343 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab235343 has not yet been referenced specifically in any publications.