Overview

  • Product name

  • Description

    Rabbit polyclonal to C16orf62
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human C16orf62 aa 859-954.
    Sequence:

    ENNKLCETVMAQILEHLKTLAKDEALKRQSSLGLSFFNSILAHGDLRNNK LNQLSVNLWHLAQRHGCADTRTMVKTLEYIKKQSKQPDMTHLTELA


    Database link: Q7Z3J2

  • Positive control

    • IHC-P: Human rectum tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224175 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Involved in copper-dependent ATP7A trafficking between the trans-Golgi network and vesicles in the cell periphery; the function is proposed to depend on its association within the CCC complex and cooperation with the WASH complex on early endosomes. Seems not to be required for CCC complex stability (PubMed:25355947).
  • Sequence similarities

    Belongs to the UPF0505 family.
  • Cellular localization

    Membrane. Early endosome.
  • Information by UniProt
  • Database links

  • Alternative names

    • C16orf62 antibody
    • Chromosome 16 open reading frame 62 antibody
    • CP062_HUMAN antibody
    • DKFZp313M0539 antibody
    • DKFZp434B0212 antibody
    • Esophageal cancer associated protein antibody
    • Esophageal cancer-associated protein antibody
    • FLJ21040; antibody
    • Hypothetical protein LOC57020 antibody
    • MGC16824 antibody
    • UPF0505 protein C16orf62 antibody
    see all

Images

  • Paraffin-embedded human rectum tissue stained for C16orf62 with ab224175 (1/200) in immunohistochemical analysis.

References

ab224175 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224175.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up