Anti-C17orf58 antibody [OTI6E9] (ab236376)
Key features and details
- Mouse monoclonal [OTI6E9] to C17orf58
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG2b
Overview
-
Product name
Anti-C17orf58 antibody [OTI6E9] -
Description
Mouse monoclonal [OTI6E9] to C17orf58 -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human C17orf58 aa 1-97. (NP_858041) produced in E.coli.
Sequence:MNRLYLTPDGFFFRVHMLALDSSSCNKPCPEFKPGSRYIVMGHIYHKRRQ LPTALLQVLRGRLRPGDGLLRSSSSYVKRFNRKREGQIQGAIHTQCI
Database link: Q2M2W7-1 -
Positive control
- WB: pCMV6-ENTRY C17orf58 cDNA transfected HEK-293T cell lysate.
-
General notes
Clone OTI6E9 (formerly 6E9).
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 1% BSA, 50% Glycerol -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant. -
Clonality
Monoclonal -
Clone number
OTI6E9 -
Isotype
IgG2b -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab236376 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/2000. Predicted molecular weight: 11 kDa. |
Target
-
Sequence similarities
Belongs to the UPF0450 family. - Information by UniProt
-
Database links
- Entrez Gene: 284018 Human
- SwissProt: Q2M2W7 Human
- Unigene: 90790 Human
-
Alternative names
- C17orf58 antibody
- Chromosome 17 open reading frame 58 antibody
- CQ058_HUMAN antibody
- UPF0450 protein C17orf58 antibody
Images
-
All lanes : Anti-C17orf58 antibody [OTI6E9] (ab236376) at 1/2000 dilution
Lane 1 : pCMV6-ENTRY control cDNA transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
Lane 2 : pCMV6-ENTRY C17orf58 cDNA transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
Lysates/proteins at 5 µg per lane.
Predicted band size: 11 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab236376 has not yet been referenced specifically in any publications.