Overview

  • Product name

    Anti-C18orf22/RBFA antibody
    See all C18orf22/RBFA primary antibodies
  • Description

    Rabbit polyclonal to C18orf22/RBFA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human C18orf22/RBFA aa 201-343.
    Sequence:

    DFGPRDERDNFVQNDFRDPDAPQPCGTTEPTTSSSLCGIDHEALNKQIME YKRRKDKGLGGLVWQGQVAELTTQMKKGRKRAKPRLEQDSSLKSYLSGEE VEDDLDLVGAPEYECYAPDTEELEAERGGGRTEDGHSCGASRE


    Database link: Q8N0V3-1

  • Positive control

    • WB: Mouse brain tissue lysate - total protein (ab4022), HeLa, A549 and HepG2 whole cell lysate (ab7900). IHC-P: Human ovarian cancer tissue. Human lung tissue.
  • General notes

     This product was previously labelled as C18orf22

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224741 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.
IHC-P 1/20 - 1/200.

Target

Images

  • All lanes : Anti-C18orf22/RBFA antibody (ab224741) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 4 : Mouse brain tissue lysate
    Lane 5 : Rat heart tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Developed using the ECL technique.
  • Paraffin embedded human ovarian cancer tissue stained for C18orf22/RBFA with ab224741 (1/100 dilution) in immunohistochemical analysis.

  • Paraffin embedded human lung tissue stained for C18orf22/RBFA with ab224741 (1/100 dilution) in immunohistochemical analysis.

References

ab224741 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224741.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up