Overview

  • Product name

    Anti-C19orf35/PEAK3 antibody
  • Description

    Rabbit polyclonal to C19orf35/PEAK3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human C19orf35/PEAK3 aa 254-311.
    Sequence:

    AAEVPERTVAQWLAEACTQPPEEFVWAVALLLLQLSAALKFLEAWGAALV ELRPENLL


    Database link: Q6ZS72

  • Positive control

    • Human cerebral cortex, tonsil and liver cancer tissues.
  • General notes

     This product was previously labelled as C19orf35

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab210955 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of paraffin-embedded Human cerebral cortex tissue, labeling C19orf35/PEAK3 using ab210955 at a 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human tonsil tissue, labeling C19orf35/PEAK3 using ab210955 at a 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue, labeling C19orf35/PEAK3 using ab210955 at a 1/200 dilution.

References

ab210955 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab210955.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up