Overview

  • Product name

  • Description

    Rabbit polyclonal to C1D
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human C1D aa 1-141.
    Sequence:

    MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPL EQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEI TDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS


    Database link: Q13901

  • Positive control

    • WB: Jurkat, Raji and NCI-H929 whole cell lysates. ICC/IF: U-2 OS cells. IHC-P: Mouse prostate and intestine tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab227860 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/3000. Predicted molecular weight: 16 kDa.
IHC-P 1/100 - 1/1000.
ICC/IF 1/100 - 1/1000.

Target

  • Function

    Plays a role in the recruitment of the RNA exosome complex to pre-rRNA to mediate the 3'-5' end processing of the 5.8S rRNA; this function may include MPHOSPH6. Can activate PRKDC not only in the presence of linear DNA but also in the presence of supercoiled DNA. Can induce apoptosis in a p53/TP53 dependent manner. May regulate the TRAX/TSN complex formation. Potentiates transcriptional repression by NR1D1 and THRB.
  • Tissue specificity

    Ubiquitous. Expressed at very high levels in the hippocampus, medulla oblongata, mammary gland, thyroid and salivary gland. Expressed at high levels in the fetal; lung, liver and kidney. Expressed at low levels in skeletal muscle, appendix, heart, lung and colon.
  • Sequence similarities

    Belongs to the C1D family.
  • Post-translational
    modifications

    Phosphorylated by PRKDC.
  • Cellular localization

    Cytoplasm. Nucleus > nucleolus. EXOSC10 is required for nucleolar localization.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1110036E10Rik antibody
    • AI875855 antibody
    • C1D antibody
    • C1D DNA binding protein antibody
    • C1D_HUMAN antibody
    • hC1D antibody
    • LRP1 antibody
    • MGC12261 antibody
    • MGC14659 antibody
    • MGC188504 antibody
    • Nuclear DNA binding protein antibody
    • Nuclear nucleic acid binding protein C1D antibody
    • Nuclear nucleic acid-binding protein C1D antibody
    • rCG23324 antibody
    • RGD1560600 antibody
    • Small unique nuclear receptor corepressor antibody
    • SUNCOR antibody
    see all

Images

  • Paraffin-embedded mouse prostate tissue stained for C1D using ab227860 at 1/500 dilution in immunohistochemical analysis.

  • All lanes : Anti-C1D antibody (ab227860) at 1/1000 dilution

    Lane 1 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 2 : Raji (human Burkitt's lymphoma cell line) whole cell lysate
    Lane 3 : NCI-H929 (human bone marrow lymphoblast cell line) whole cell lysate

    Lysates/proteins at 30 µg per lane.

    Predicted band size: 16 kDa



    15 % SDS-PAGE gel.

  • U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for C1D (green) using ab227860 at 1/500 dilution in ICC/IF. Cells were fixed in 4% paraformaldehyde at RT for 15 minutes.

    Blue: Hoechst 33342 staining.

  • Paraffin-embedded mouse intestine tissue stained for C1D using ab227860 at 1/500 dilution in immunohistochemical analysis.

References

ab227860 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab227860.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up