Overview

  • Product name

  • Description

    Rabbit polyclonal to C1GALT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human C1GALT1 aa 34-143.
    Sequence:

    KVDTQPNVLHNDPHARHSDDNGQNHLEGQMNFNADSSQHKDENTDIAENL YQKVRILCWVMTGPQNLEKKAKHVKATWAQRCNKVLFMSSEENKDFPAVG LKTKEGRDQL


    Database link: Q9NS00

  • Positive control

    • WB: U-251 MG and HepG2 whole cell lysates. IHC-P: Human colon cancer and kidney tissues. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237734 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/5000. Predicted molecular weight: 42 kDa.
ICC/IF 1/200 - 1/500.

Target

  • Relevance

    C1GALT1 (Core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1) is a glycosyltransferase that generates the core 1 O-glycan Gal-beta1-3GalNAc-alpha1-Ser/Thr (T antigen), which is synthesized by the transfer of Gal from UDP-Gal to GalNAc-alpha-1-R. Core 1 is a precursor for many extended O-glycans in glycoproteins. C1GALT1 plays a central role in many processes, such as angiogenesis, thrombopoiesis and kidney homeostasis development.
  • Cellular localization

    Membrane; Single-pass type II membrane protein.
  • Database links

  • Alternative names

    • B3Gal T8 antibody
    • Beta 1 3 galactosyltransferase antibody
    • C1GALT antibody
    • Core 1 beta1 3 galactosyltransferase 1 antibody
    • Core 1 beta3 Gal T antibody
    • Core 1 O glycan T synthase antibody
    • Core 1 synthase glycoprotein N acetylgalactosamine 3 beta galactosyltransferase 1 antibody
    • Core 1 UDP galactose:N acetylgalactosamine alpha R beta 1 3 galactosyltransferase antibody
    • Glycoprotein N acetylgalactosamine 3 beta galactosyltransferase 1 antibody
    • T synthase antibody
    see all

Images

  • All lanes : Anti-C1GALT1 antibody (ab237734) at 1/500 dilution

    Lane 1 : U-251 MG (human brain glioma cell line) whole cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 42 kDa

  • Paraffin-embedded human colon cancer tissue stained for C1GALT1 using ab237734 at 1/1000 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • Paraffin-embedded human kidney tissue stained for C1GALT1 using ab237734 at 1/1000 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for C1GALT1 (green) using ab237734 at 1/333 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L). The nuclear counter stain is DAPI.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C. 

References

ab237734 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237734.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up