Overview

  • Product name

  • Description

    Rabbit polyclonal to C1orf101
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human C1orf101 aa 20-832.
    Sequence:

    LWRYSTNSPNYRIFSTRSTIKLEYEGTLFTEWSVPETCFVLNKSSPTTEL RCSSPGVHAIKPIVTGPDEEERYLFVESSHTCFLWYYRVRHFFNNFTQLI TVWAYDPESADPDELLGNAEEPSINSIVLSTQMATLGQKPVIHTVLKRKV YSSNEKMRRGTWRIVVPMTKDDALKEIRGNQVTFQDCFIADFLILLTFPL LTIPEIPGYLPISSPRGSQLMASWDACVVASAVLVTDMETFHTTDSFKSW TRIRVPPDILSDDERRSVAHVILSRDGIVFLINGVLYIKSFRGFIRLGGI VNLPDGGITGISSRKWCWVNYLLKAKGRRSTFAVWTENEIYLGSILLKFA RLVTTTELKNILSLSVTATLTIDRVEYTGHPLEIAVFLNYCTVCNVTKKI FLVIYNEDTKQWVSQDFTLDAPIDSVTMPHFTFSALPGLLLWNKHSIYYC YHNFTFTGILQTPAGHGNLSMLSNDSIIHEVFIDYYGDILVKMENNVIFY SKINTRDAVKLHLWTNYTTRAFIFLSTSGQTYFLYALDDGTIQIQDYPLH LEAQSIAFTTKDKCPYMAFHNNVAHVFYFLDKGEALTVWTQIVYPENTGL YVIVESYGPKILQESHEISFEAAFGYCTKTLTLTFYQNVDYERISDYFET QDKHTGLVLVQFRPSEYSKACPIAQKVFQIAVGCDDKKFIAIKGFSKKGC HHHDFSYVIEKSYLRHQPSKNLRVRYIWGEYGCPLRLDFTEKFQPVVQLF DDNGYVKDVEANFIVWEIHGRDDYSFNNTMAQSGCLHEAQTWKSMIELNK HLPLEEVWGPEFL


    Database link: Q5SY80-2

  • Positive control

    • WB: U-87 MG, HepG2, A549 and PC-3 whole cell lysates; Mouse lung and liver lysates. IHC-P: Human colon cancer and pancreatic cancer tissues. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236988 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 96 kDa.

Target

Images

  • All lanes : Anti-C1orf101 antibody (ab236988) at 1/500 dilution

    Lane 1 : U-87 MG (human glioblastoma-astrocytoma epithelial cell line) cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
    Lane 3 : A549 (human lung carcinoma cell line) cell lysate
    Lane 4 : Mouse lung lysate
    Lane 5 : Mouse liver lysate
    Lane 6 : PC-3 (human prostate adenocarcinoma cell line) cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 96 kDa

  • Paraffin-embedded human pancreatic cancer tissue stained for C1orf101 using ab236988 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon cancer tissue stained for C1orf101 using ab236988 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for C1orf101 (green) using ab236988 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-conjugated goat anti-rabbit IgG (H+L).

References

ab236988 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236988.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up