Overview

  • Product name

    Anti-C1orf106/INAVA antibody
  • Description

    Rabbit polyclonal to C1orf106/INAVA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human C1orf106/INAVA aa 297-377.
    Sequence:

    PPQTLEGLQPTGPEAGSPERAPVQNSPWKETSLDHPYEKPRKSSEPWSES SSPATTPQDGPSASSLWLLEPASYHVVPIRG


    Database link: Q3KP66

  • Positive control

    • RT-4 lysate
  • General notes

     This product was previously labelled as C1orf106

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab121945 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000.

Target

Images

  • All lanes : Anti-C1orf106/INAVA antibody (ab121945) at 1/250 dilution

    Lane 1 : RT-4 lysate
    Lane 2 : U-251 MG lysate

    Lane 3 : Human plasma lysate

    Lane 4 : Human liver lysate

    Lane 5 : Human tonsil lysate

References

This product has been referenced in:

  • Yan J  et al. An inflammatory bowel disease-risk variant in INAVA decreases pattern recognition receptor-induced outcomes. J Clin Invest 127:2192-2205 (2017). Read more (PubMed: 28436939) »
See 1 Publication for this product

Customer reviews and Q&As

Application
Western blot
Sample
Human Cell lysate - whole cell (macrophage)
Gel Running Conditions
Reduced Denaturing
Loading amount
30 µg
Specification
macrophage
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Dec 12 2014

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up