Anti-C1orf172 antibody (ab224760)
Key features and details
- Rabbit polyclonal to C1orf172
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-C1orf172 antibody -
Description
Rabbit polyclonal to C1orf172 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human C1orf172 aa 288-370.
Sequence:LDEQDAEGRLVRGIIRISTRKSRARPQTSEGRSTRAAAPTAAAPDSGHET MVGSGLSQDELTVQISQETTADAIARKLRPYGA
Database link: Q8NAX2 -
Positive control
- WB: C1orf172 over-expression - HEK-293T whole cell lysates; IHC-P: Human seminal vesicle tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab224760 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 43 kDa. | |
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
- Information by UniProt
-
Database links
- Entrez Gene: 126695 Human
- Entrez Gene: 69073 Mouse
- Entrez Gene: 313018 Rat
- Omim: 616758 Human
- SwissProt: Q8NAX2 Human
- SwissProt: A2A9F4 Mouse
- SwissProt: Q6AY88 Rat
- Unigene: 188881 Human
-
Alternative names
- C1orf172 antibody
- CA172_HUMAN antibody
- Chromosome 1 open reading frame 172 antibody
see all
Images
-
All lanes : Anti-C1orf172 antibody (ab224760) at 0.4 µg/ml
Lane 1 : Control (vector only transfected) - HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
Lane 2 : C1orf172 over-expression - HEK-293T whole cell lysate; Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa)
Predicted band size: 43 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-C1orf172 antibody (ab224760)
Immunohistochemical analysis of human seminal vesicle tissue labeling C1orf172 in the cytoplasm of glandular cells with ab224760 at 1/50 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (1)
ab224760 has been referenced in 1 publication.
- Zeng B et al. KDF1 is a novel candidate gene of non-syndromic tooth agenesis. Arch Oral Biol 97:131-136 (2019). PubMed: 30384154