Overview

  • Product name

    Anti-C1orf173/ERICH3 antibody
  • Description

    Rabbit polyclonal to C1orf173/ERICH3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human C1orf173/ERICH3.
    Sequence:

    DTGPMEDTASKREDGSEEAILGGEEPAKERKEVMRTETRLSPFTGEAEAS RMQVSEGSPEEGSLAKEAFLCKEDVEGEEMVTEAEANREDDRKEILPKE

  • Positive control

    • Human bronchus tissue.
  • General notes

     This product was previously labelled as C1orf173

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab126504 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Information by UniProt
  • Database links

  • Alternative names

    • C1orf173 antibody
    • CA173_HUMAN antibody
    • Chromosome 1 open reading frame 173 antibody
    • DKFZp547I048 antibody
    • DKFZp761G1720 antibody
    • DKFZp781L0319 antibody
    • Hypothetical protein LOC127254 antibody
    • MGC90412 antibody
    • OTTHUMP00000011196 antibody
    • RP11-653A5.1 antibody
    • Uncharacterized protein C1orf173 antibody
    see all

Images

  • Immunofluorescent staining of Human cell line U-251MG shows positivity in nuclear membrane and cytoplasm. Recommended concentration of ab126504 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • ab126504, at 1/50 dilution, staining C1orf173/ERICH3 in paraffin embedded Human bronchus tissue by Immunohistochemistry.

References

ab126504 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
IHC - Wholemount
Sample
Mouse Tissue (Inner Ear Cochlea)
Specification
Inner Ear Cochlea

Chelsee Strojny

Verified customer

Submitted Nov 12 2015

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up