Overview

  • Product name

    Anti-C1orf25 antibody
  • Description

    Rabbit polyclonal to C1orf25
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human C1orf25 aa 574-671.
    Sequence:

    QFSIHASSNVNKQEENGVFIKTTDDTTTDNYIAQGKRKSNEMITNLGKKQ KTDVSTEHPPFYYNIHRHSIKGMNMPKLKKFLCYLSQAGFRVSRTHFD


    Database link: Q7Z2T5

  • Positive control

    • Human placenta tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab121883 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunofluorescent staining of Human cell line A-431 shows positivity in nucleus and nucleoli. Recommended concentration of ab121883 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • ab121883 at 1/200 dilution staining C1orf25 in Paraffin-embedded Human Placenta tissue by Immunohistochemistry.
  • All lanes : Anti-C1orf25 antibody (ab121883)

    Lane 1 : Negative control (vector only transfected HEK293T lysate)
    Lane 2 : Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells.


    Marker [kDa] 250; 130; 95; 72; 55; 36; 28; 17; 10.

References

ab121883 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab121883.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up