Overview

  • Product name

    Anti-C1orf43/NICE3 antibody
  • Description

    Rabbit polyclonal to C1orf43/NICE3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human C1orf43/NICE3 aa 179-228 (internal sequence).
    Sequence:

    YQEALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQ


    Database link: NP_001092086

  • General notes

     This product was previously labelled as C1orf43

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab104168 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 29 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4933434E20Rik antibody
    • AI462154 antibody
    • C1orf43 antibody
    • CA043_HUMAN antibody
    • Chromosome 1 open reading frame 43 antibody
    • HCV NS5A transactivated protein 4 antibody
    • HCV NS5A-transactivated protein 4 antibody
    • Hepatitis C virus NS5A transactivated protein 4 antibody
    • Hepatitis C virus NS5A-transactivated protein 4 antibody
    • HSPC012 antibody
    • Hypothetical protein LOC25912 antibody
    • MGC111001 antibody
    • NICE 3 antibody
    • NICE3 antibody
    • NS5ATP4 antibody
    • OTTHUMP00000034199 antibody
    • OTTHUMP00000034201 antibody
    • OTTHUMP00000034202 antibody
    • Protein NICE 3 antibody
    • Protein NICE-3 antibody
    • Riken cDNA 4933434E20 antibody
    • S863 3 antibody
    • S863-3 antibody
    • Uncharacterized protein C1orf43 antibody
    see all

Images

  • Anti-C1orf43/NICE3 antibody (ab104168) (0.2-1 ug/ml) + Human Muscle

    Predicted band size: 29 kDa

References

This product has been referenced in:

  • Chen SJ  et al. A splice variant of the human ion channel TRPM2 modulates neuroblastoma tumor growth through hypoxia-inducible factor (HIF)-1/2a. J Biol Chem 289:36284-302 (2014). WB . Read more (PubMed: 25391657) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104168.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up