Overview

  • Product name

    Anti-C1orf69/IBA57 antibody
    See all C1orf69/IBA57 primary antibodies
  • Description

    Rabbit polyclonal to C1orf69/IBA57
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human C1orf69/IBA57 aa 286-356.
    Sequence:

    DPLPTSGITPGATVLTASGQTVGKFRAGQGNVGLALLWSEKIKGPLHIRA SEGAQVALAASVPDWWPTVSK


    Database link: Q5T440

  • Positive control

    • WB: MCF7, HEK-293T and HepG2 whole cell lysate; Mouse liver tissue lysate. IHC-P: Human lymph node and prostate tissue. ICC/IF: PC-3 cells.
  • General notes

     This product was previously labelled as C1orf69

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab237489 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/200 - 1/500.
WB 1/500 - 1/5000. Predicted molecular weight: 38 kDa.

Target

  • Function

    Required for normal heme biosynthesis.
  • Sequence similarities

    Belongs to the gcvT family. CAF17 subfamily.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • C1orf69 antibody
    • CAF17_HUMAN antibody
    • Chromosome 1 open reading frame 69 antibody
    • FLJ12734 antibody
    • FLJ13849 antibody
    • IBA57 antibody
    • IBA57 homolog iron sulfur cluster assembly antibody
    • IBA57 iron sulfur cluster assembly homolog antibody
    • IBA57 iron sulfur cluster assembly homolog (S. cerevisiae) antibody
    • IBA57, S. cerevisiae, homolog of antibody
    • Iron sulfur cluster assembly factor for biotin synthase and aconitase like antibody
    • iron-sulfur cluster assembly factor for biotin synthase- and aconitase-like mitochondrial proteins, with a mass of 57kDa antibody
    • Iron-sulfur cluster assembly factor homolog antibody
    • Mitochondrial proteins with a mass of 57kDa antibody
    • MMDS3 antibody
    • Putative transferase C1orf69 mitochondrial antibody
    • Putative transferase CAF17, mitochondrial antibody
    • SPG74 antibody
    see all

Images

  • PC-3 (human prostate adenocarcinoma cell line) cells stained for C1orf69/IBA57 (green) using ab237489 at 1/133 dilution in ICC/IF, followed by Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C. Counterstained with DAPI.

  • Paraffin-embedded human prostate tissue stained for C1orf69/IBA57 using ab237489 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • Paraffin-embedded human lymph node tissue stained for C1orf69/IBA57 using ab237489 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • All lanes : Anti-C1orf69/IBA57 antibody (ab237489) at 1/500 dilution

    Lane 1 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 3 : HEPG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 4 : Mouse liver tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 38 kDa

References

ab237489 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237489.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up