Overview

  • Product name

  • Description

    Rabbit polyclonal to C1orf85
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Mouse C1orf85 aa 246-404. (N-terminal His-tag and GST-tag; Expressed in E.coli).
    Sequence:

    PSVNERNSIDDEYAPAVFQLNQLLWGSSPSGFMQWRPVAFSEEERARESA LPCQASTLHSTLASSLPHSPIVQAFFGSQNNFCAFNLTFGAPTGPGYWDQ YYLCWSMLLGMGFPPVDIFSPLVLGIMAVALGAPGLMFLGGGLFLLLRHR RYSEYQSIN


    Database link: Q9JHJ3

  • Positive control

    • IHC-P: Mouse liver tissue. WB: Mouse liver lysate; Recombinant mouse C1orf85 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231317 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231317 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 44 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Post-translational
    modifications

    Highly N-glycosylated.
  • Cellular localization

    Lysosome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • C1orf85 antibody
    • Chromosome 1 open reading frame 85 antibody
    • GLMP antibody
    • Glycosylated lysosomal membrane protein antibody
    • Kidney lysosomal membrane protein antibody
    • Kidney predominant protein NCU-G1 antibody
    • Lysosomal protein NCU-G1 antibody
    • NCU G1 antibody
    • NCUG1_HUMAN antibody
    • PSEC0030 antibody
    • UNQ2553/PRO6182 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse liver tissue stained for C1orf85 using ab231317 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-C1orf85 antibody (ab231317) at 2 µg/ml + Recombinant mouse C1orf85 protein.

    Predicted band size: 44 kDa

  • Anti-C1orf85 antibody (ab231317) at 2 µg/ml + Mouse liver lysate.

    Predicted band size: 44 kDa

References

ab231317 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231317.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up