Overview

  • Product name

    Anti-C1QTNF9B-AS1 antibody
  • Description

    Rabbit polyclonal to C1QTNF9B-AS1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human C1QTNF9B-AS1 aa 50-100.
    Sequence:

    PRTPGSPWGPVGPASPLGPGFPIGPMGPGKPVGPKGPMLPLGPSGPVGPT S


    Database link: Q58A44

  • Positive control

    • IHC: Human prostrate cancer and testis tissue. ICC/IF: HeLa cells.
  • General notes

     This product was previously labelled as PCOTH

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223069 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    May be involved in growth and survival of prostate cancer cells through the TAF-Ibeta pathway.
  • Tissue specificity

    Expressed in prostate and testis. Weakly or not expressed in other tissues. Overexpressed in prostate cancers.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • C1QTNF9B antisense RNA 1 (non-protein coding) antibody
    • PCOTH antibody
    • PCOTH_HUMAN antibody
    • Prostate collagen triple helix protein antibody
    • Protein PCOTH antibody
    see all

Images

  • Paraffin-embedded human prostate cancer tissue stained for C1QTNF9B-AS1 using ab223069 at 1/100 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for C1QTNF9B-AS1 (green) using ab223069 at 1/100 dilution in ICC/IF. Secondary: Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human testis tissue stained for C1QTNF9B-AS1 using ab223069 at 1/100 dilution in immunohistochemical analysis.

References

ab223069 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223069.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up