Overview

  • Product name

  • Description

    Rabbit polyclonal to C1r
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human C1r aa 1-705.
    Sequence:

    MLPRLLLLICAPLCEPAELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQF QFCFFRDTRALGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRR SQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKG AVGLNLQSKTQRSLTAEYEIPSVRESDAEQYYCVAENGYGPSPSGLVSIT VRIPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPILYWFYHEDITLG SRSAPSGGGASFNLSLTEEHSGNYSCEANNGLGAQRSEAVTLNFTVPTGA RSNHLTSGVIEGLLSTLGPATVALLFCYGLKRKIGRRSARDPLRSLPSPL PQEFTYLNSPTPGQLQPIYENVNVVSGDEVYSLAYYNQPEQESVAAETLG THMEDKVSLDIYSRLRKANITDVDYEDAM


    Database link: P00736

  • Positive control

    • Mouse bone marrow lysate; Mouse lung tissue; HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab205546 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 80 kDa.
IHC-P 1/50 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 2 CUB domains.
    Contains 1 EGF-like domain.
    Contains 1 peptidase S1 domain.
    Contains 2 Sushi (CCP/SCR) domains.
  • Post-translational
    modifications

    The iron and 2-oxoglutarate dependent 3-hydroxylation of aspartate and asparagine is (R) stereospecific within EGF domains.
  • Information by UniProt
  • Database links

  • Alternative names

    • C1 R antibody
    • C1R antibody
    • C1R_HUMAN antibody
    • Complement C1r antibody
    • Complement C1r subcomponent antibody
    • Complement C1r subcomponent light chain antibody
    • Complement C1r subcomponent precursor antibody
    • Complement component 1 r subcomponent antibody
    • Complement component 1 subcomponent r antibody
    see all

Images

  • Anti-C1r antibody (ab205546) at 1/500 dilution + Mouse bone marrow lysate

    Predicted band size: 80 kDa

  • Immunofluorescent analysis of HeLa cells labeling C1r with ab205546 at 1/50 and DAPI staining (blue).

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Mouse lung tissue labeling C1r with ab205546 at 1/100.

References

ab205546 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205546.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up