Overview

  • Product name

  • Description

    Rabbit polyclonal to C2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Rat C2 aa 423-723. (Expressed in E.coli).
    Sequence:

    DVDWKELNELGSKKDGERHAFILQDAKAVQQVFEHILDVSKLTDTICGVG NMSVNASDQERTPWQVTFKPKSKETCQGSLISDQWVLTAAHCFHDAQMED RHLWRVIVGDPTSHHGKEFHVEEVLVAPGFNVHAKQSQGISEFYADDIAL LKLSQRVKMSSHARPICLPCTVGANMALRRSPGSTCKDHETELLSQQKVP AHFVALNGNRMNINLRTGPERTSCIEAVSQNKGSFPGLTNVSEVVTDQFL CSGMEGDDSPCKGESGGAVFLERRYRFFQVGLVSWGLFDPCHGSSNKNLR R


    Database link: Q6MG73

  • Positive control

    • IHC-P: Rat testis, stomach, small intestine and heart tissues. WB: Rat serum; Recombinant rat C2 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231651 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231651 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 84 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Component C2 which is part of the classical pathway of the complement system is cleaved by activated factor C1 into two fragments: C2b and C2a. C2a, a serine protease, then combines with complement factor 4b to generate the C3 or C5 convertase.
  • Involvement in disease

    Defects in C2 are the cause of complement component 2 deficiency (C2D) [MIM:217000]. A deficiency of the complement classical pathway associated with the development of autoimmune disorders, mainly systemic lupus erythematosus. Skin and joint manifestations are common and renal disease is relatively rare. Patients with complement component 2 deficiency are also reported to have recurrent or invasive infections.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
    Contains 3 Sushi (CCP/SCR) domains.
    Contains 1 VWFA domain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARMD14 antibody
    • C2 antibody
    • C3/C5 convertase antibody
    • CO2 antibody
    • CO2_HUMAN antibody
    • Complement C2 antibody
    • Complement C2a fragment antibody
    • complement component 2 antibody
    • DKFZp779M0311 antibody
    see all

Images

  • Paraffin-embedded rat testis tissue stained for C2 using ab231651 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat stomach tissue stained for C2 using ab231651 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat small intestine tissue stained for C2 using ab231651 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat heart tissue stained for C2 using ab231651 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-C2 antibody (ab231651) at 1 µg/ml + Recombinant rat C2 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 84 kDa

  • Anti-C2 antibody (ab231651) at 1 µg/ml + Rat serum

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 84 kDa

References

ab231651 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231651.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up