Overview

  • Product name

    Anti-C20orf112/NOL4L antibody
  • Description

    Rabbit polyclonal to C20orf112/NOL4L
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human C20orf112/NOL4L aa 101-300.
    Sequence:

    LGTASYPSDGCGADGLRSRVKYGVKTTPESPPYSSGSYDSIKTEVSGCPE DLTVGRAPTADDDDDDHDDHEDNDKMNDSEGMDPERLKAFNMFVRLFVDE NLDRMVPISKQPKEKIQAIIESCSRQFPEFQERARKRIRTYLKSCRRMKK NGMEMTRPTPPHLTSAMAENILAAACESETRKAAKRMRLEIYQSSQDEPI


    Database link: Q96MY1

  • Positive control

    • WB: PC-3, A549, HepG2 and K562 whole cell lysates. IHC-P: Human thyroid, testis, small intestine and adrenal gland tissues. ICC/IF: HeLa cells.
  • General notes

     This product was previously labelled as C20orf112

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237758 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 47 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

Images

  • All lanes : Anti-C20orf112/NOL4L antibody (ab237758) at 1/500 dilution

    Lane 1 : PC-3 (human prostate adenocarcinoma cell line) whole cell lysate
    Lane 2 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 4 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 47 kDa

  • Paraffin-embedded human thyroid tissue stained for C20orf112/NOL4L with ab237758 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for C20orf112/NOL4L with ab237758 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human adrenal gland tissue stained for C20orf112/NOL4L with ab237758 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human small intestine tissue stained for C20orf112/NOL4L with ab237758 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for C20orf112/NOL4L (green) using ab237758 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab237758 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237758.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up