Overview

  • Product name

    Anti-C21orf2 antibody - C-terminal
    See all C21orf2 primary antibodies
  • Description

    Rabbit polyclonal to C21orf2 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human C21orf2 aa 132-181 (C terminal). The exact sequence is proprietary. Isoform short.
    Sequence:

    DPLDSEEEATSGAQDERGLKPPSRGQFPSLSARDASSSHRGRNVLTAILL


    Database link: O43822-2

  • Positive control

    • THP1 whole cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab179686 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa.

Target

  • Function

    May play roles in cilia formation and/or maintenance (By similarity). Plays a role in the regulation of cell morphology and cytoskeletal organization.
  • Sequence similarities

    Contains 3 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    To C.elegans F09G8.5.
  • Information by UniProt
  • Database links

  • Alternative names

    • A2 antibody
    • C21orf HUMF09G8.5 antibody
    • C21orf-HUMF09G8.5 antibody
    • C21orf2 antibody
    • Chromosome 21 open reading frame 2 antibody
    • CU002_HUMAN antibody
    • Hypothetical protein LOC755 antibody
    • Nuclear encoded mitochondrial protein cDNA A2 YF5 antibody
    • Protein C21orf2 antibody
    • Uncharacterized protein C21orf2 antibody
    • YF 5 antibody
    • YF5 antibody
    • YF5/A2 antibody
    see all

Images

  • Anti-C21orf2 antibody - C-terminal (ab179686) at 1 µg/ml + THP1 whole cell lysate at 10 µg

    Predicted band size: 24 kDa

References

ab179686 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179686.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up