Overview

  • Product name

  • Description

    Rabbit polyclonal to C21orf33
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human C21orf33 aa 43-268.
    Sequence:

    ARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDH TKGQPSEGESRNVLTESARIARGKITDLANLSAANHDAAIFPGGFGAAKN LSTFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAPVLAAKVLRGVEV TVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAF MCETALHYIHDGIGAMVRKVLELTGK


    Database link: P30042-1

  • Positive control

    • WB: EC109 and HEK-293T whole cell lysates. IHC-P: Human glioma and kidney tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab236097 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 28 kDa.
IHC-P 1/20 - 1/200.

Target

  • Relevance

    C21orf33 encodes a 268 amino acid protein which shares significant homology with Escherichia coli anti-sigma cross-reacting protein (SCRP-27A/SCRP27) and zebrafish Es1 protein. The specific function of the C21orf33 protein is not known.
  • Cellular localization

    Mitochondrial
  • Database links

  • Alternative names

    • Chromosome 21 open reading frame 33 antibody
    • D21S2048E antibody
    • ES 1 antibody
    • ES1 antibody
    • Es1 protein antibody
    • ES1 protein homolog mitochondrial antibody
    • GT335 antibody
    • HES 1 antibody
    • HES1 antibody
    • Human HES1 protein homolog to E.coli and zebrafish ES1 protein antibody
    • Keio novel protein I antibody
    • KNP I antibody
    • KNPH antibody
    • KNPI antibody
    • Protein GT335 antibody
    • Protein KNP I antibody
    see all

Images

  • All lanes : Anti-C21orf33 antibody (ab236097) at 1/1000 dilution

    Lane 1 : EC109 whole cell lysate
    Lane 2 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/15000 dilution

    Predicted band size: 28 kDa

  • Paraffin-embedded human kidney tissue stained for C21orf33 with ab236097 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human glioma tissue stained for C21orf33 with ab236097 at 1/100 dilution in immunohistochemical analysis.

References

ab236097 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236097.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up