Overview

  • Product name

    Anti-C21orf66 antibody
  • Description

    Rabbit polyclonal to C21orf66
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Pig, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human C21orf66 aa 225-275. The exact sequence is proprietary. (NP_057715.2).
    Sequence:

    IHAARKKRQMARELGDFTPHDNEPGKGRLVREDENDASDDEDDDEKRRIV F


    Database link: Q9Y5B6

  • Positive control

    • HeLa and 293T whole cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 99% Tris buffered saline, 0.1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab176590 was affinity purified using an epitope specific to C21orf66 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab176590 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 105 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

Images

  • Detection of C21orf66 by Western Blot of Immunprecipitate.
    ab176590 at 1µg/ml labeling C21orf66 in HeLa whole cell lysate (1 mg/IP; 20% of IP loaded) immunoprecipitated using ab176590 at 6µg/mg lysate.

    Detection: Chemiluminescence with exposure time of 3 seconds.

  • All lanes : Anti-C21orf66 antibody (ab176590) at 0.04 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 5 µg
    Lane 4 : 293T whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 105 kDa


    Exposure time: 30 seconds

References

ab176590 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176590.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up