Anti-C22orf28 antibody (ab236946)
Key features and details
- Rabbit polyclonal to C22orf28
- Suitable for: IHC-P, WB, ICC/IF
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-C22orf28 antibody
See all C22orf28 primary antibodies -
Description
Rabbit polyclonal to C22orf28 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat, Guinea pig, Cow, Pig, Zebrafish, Cynomolgus monkey, Xenopus tropicalis -
Immunogen
Recombinant fragment corresponding to Human C22orf28 aa 52-229.
Sequence:NACRGGGVGGFLPAMKQIGNVAALPGIVHRSIGLPDVHSGYGFAIGNMAA FDMNDPEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHI PVGVGSKGVIPMNAKDLEEALEMGVDWSLREGYAWAEDKEHCEEYGRMLQ ADPNKVSARAKKRGLPQLGTLGAGNHYA
Database link: Q9Y3I0 -
Positive control
- WB: NIH/3T3 and HEK-293 whole cell lysates. IHC-P: Human colon cancer and glioma tissues. ICC/IF: HeLa cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab236946 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. | |
WB | 1/1000 - 1/5000. Predicted molecular weight: 55 kDa. | |
ICC/IF | 1/50 - 1/200. |
Target
-
Function
Catalytic subunit of the tRNA-splicing ligase complex that acts by directly joining spliced tRNA halves to mature-sized tRNAs by incorporating the precursor-derived splice junction phosphate into the mature tRNA as a canonical 3',5'-phosphodiester. May act as an RNA ligase with broad substrate specificity, and may function toward other RNAs. -
Sequence similarities
Belongs to the RtcB family. -
Cellular localization
Nucleus. Cytoplasm. Enters into the nucleus in case of active transcription while it accumulates in cytosol when transcription level is low. - Information by UniProt
-
Database links
- Entrez Gene: 525106 Cow
- Entrez Gene: 102144880 Cynomolgus monkey
- Entrez Gene: 51493 Human
- Entrez Gene: 28088 Mouse
- Entrez Gene: 733658 Pig
- Entrez Gene: 362855 Rat
- Entrez Gene: 595066 Xenopus tropicalis
- Entrez Gene: 406376 Zebrafish
see all -
Alternative names
- Ankyrin repeat domain 54 antibody
- Chromosome 22 open reading frame 28 antibody
- DJ149A16.6 antibody
see all
Images
-
All lanes : Anti-C22orf28 antibody (ab236946) at 1/1000 dilution
Lane 1 : NIH/3T3 (mouse embyro fibroblast cell lin) whole cell lysate
Lane 2 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
Predicted band size: 55 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-C22orf28 antibody (ab236946)
Paraffin-embedded human colon cancer tissue stained for C22orf28 using ab236946 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-C22orf28 antibody (ab236946)
Paraffin-embedded human glioma tissue stained for C22orf28 using ab236946 at 1/100 dilution in immunohistochemical analysis.
-
HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for C22orf28 (green) using ab236946 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab236946 has not yet been referenced specifically in any publications.