Anti-C22orf28 antibody (ab236946)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-C22orf28 antibody
See all C22orf28 primary antibodies -
Description
Rabbit polyclonal to C22orf28 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat, Guinea pig, Cow, Pig, Zebrafish, Cynomolgus monkey, Xenopus tropicalis
-
Immunogen
Recombinant fragment corresponding to Human C22orf28 aa 52-229.
Sequence:NACRGGGVGGFLPAMKQIGNVAALPGIVHRSIGLPDVHSGYGFAIGNMAA FDMNDPEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHI PVGVGSKGVIPMNAKDLEEALEMGVDWSLREGYAWAEDKEHCEEYGRMLQ ADPNKVSARAKKRGLPQLGTLGAGNHYA
Database link: Q9Y3I0 -
Positive control
- WB: NIH/3T3 and HEK-293 whole cell lysates. IHC-P: Human colon cancer and glioma tissues. ICC/IF: HeLa cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.03% Proclin
Constituents: 50% Glycerol, PBS -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab236946 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/20 - 1/200. | |
| WB | 1/1000 - 1/5000. Predicted molecular weight: 55 kDa. | |
| ICC/IF | 1/50 - 1/200. |
Target
-
Function
Catalytic subunit of the tRNA-splicing ligase complex that acts by directly joining spliced tRNA halves to mature-sized tRNAs by incorporating the precursor-derived splice junction phosphate into the mature tRNA as a canonical 3',5'-phosphodiester. May act as an RNA ligase with broad substrate specificity, and may function toward other RNAs. -
Sequence similarities
Belongs to the RtcB family. -
Cellular localization
Nucleus. Cytoplasm. Enters into the nucleus in case of active transcription while it accumulates in cytosol when transcription level is low. - Information by UniProt
-
Database links
- Entrez Gene: 525106 Cow
- Entrez Gene: 102144880 Cynomolgus monkey
- Entrez Gene: 51493 Human
- Entrez Gene: 28088 Mouse
- Entrez Gene: 733658 Pig
- Entrez Gene: 362855 Rat
- Entrez Gene: 595066 Xenopus tropicalis
- Entrez Gene: 406376 Zebrafish
see all -
Alternative names
- Ankyrin repeat domain 54 antibody
- Chromosome 22 open reading frame 28 antibody
- DJ149A16.6 antibody
see all
Images
-
Western blot - Anti-C22orf28 antibody (ab236946)All lanes : Anti-C22orf28 antibody (ab236946) at 1/1000 dilution
Lane 1 : NIH/3T3 (mouse embyro fibroblast cell lin) whole cell lysate
Lane 2 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
Predicted band size: 55 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-C22orf28 antibody (ab236946)Paraffin-embedded human colon cancer tissue stained for C22orf28 using ab236946 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-C22orf28 antibody (ab236946)Paraffin-embedded human glioma tissue stained for C22orf28 using ab236946 at 1/100 dilution in immunohistochemical analysis.
-
Immunocytochemistry/ Immunofluorescence - Anti-C22orf28 antibody (ab236946)HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for C22orf28 (green) using ab236946 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).
References
ab236946 has not yet been referenced specifically in any publications.
