Overview

  • Product name

    Anti-C2orf40/ECRG4 antibody
    See all C2orf40/ECRG4 primary antibodies
  • Description

    Rabbit polyclonal to C2orf40/ECRG4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human C2orf40/ECRG4 aa 40-146.
    Sequence:

    KREAPVPTKTKVAVDENKAKEFLGSLKRQKRQLWDRTRPEVQQWYQQFLY MGFDEAKFEDDITYWLNRDRNGHEYYGDYYQRHYDEDSAIGPRSPYGFRH GASVNYD


    Database link: Q9H1Z8

  • Positive control

    • WB: C2orf40/ECRG4 overexpression HEK-293T cell lysate. IHC-P: Human skeletal muscle tissue.
  • General notes

     This product was previously labelled as C2orf40

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224077 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 17 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Paraffin embedded human skeletal muscle tissue stained for C2orf40/ECRG4 with ab224077 (1/200 dilution) in immunohistochemical analysis.

  • All lanes : Anti-C2orf40/ECRG4 antibody (ab224077) at 1/100 dilution

    Lane 1 : Negative control (vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) ) cell lysate
    Lane 2 : C2orf40/ECRG4 overexpression (with C-terminal myc-DDK tag, ~3.1 kDa) in HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen), cell lysate

    Predicted band size: 17 kDa

References

ab224077 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224077.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up