Overview

  • Product name

  • Description

    Rabbit polyclonal to C3Orf34
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human C3Orf34 aa 84-163.
    Sequence:

    QSLAETMEQIQRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKKKDD PNFVYDIEVEFPQDDQLQSCGWDTESADEF


    Database link: Q96LK0

  • Positive control

    • ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221816 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Fixation/Permeabilization: PFA/Triton X-100.

 

Target

  • Relevance

    C3Orf34 (HSD5) is an uncharacterized protein. This is a soluble protein with a phosphoenol pyruvate carboxylase (Ppc) domain starting near the N-terminus. The presence of a Ppc domain in HSD5 suggests that this protein may be involved in energy production and conversion pathways. The HSD5 gene is up-regulated in various tumour cell lines.
  • Database links

  • Alternative names

    • Centrosomal protein 19 antibody
    • Centrosomal protein 19kDa antibody
    • Chromosome 3 open reading frame 34 antibody
    • HSD5 antibody
    • LOC84984 antibody
    • MGC14126 antibody
    • MOSPGF antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for C3Orf34 (green) using ab221816 at 4 µg/ml in ICC/IF.

References

ab221816 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221816.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up