Anti-C3Orf34 antibody (ab229712)
Key features and details
- Rabbit polyclonal to C3Orf34
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-C3Orf34 antibody
See all C3Orf34 primary antibodies -
Description
Rabbit polyclonal to C3Orf34 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cow -
Immunogen
Recombinant full length protein corresponding to Human C3Orf34 aa 1-163.
Sequence:MMCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAE QLKNNPRHKSYLEQVSLRQLEKLFSFLRGYLSGQSLAETMEQIQRETTID PEEDLNKLDDKELAKRKSIMDELFEKNQKKKDDPNFVYDIEVEFPQDDQL QSCGWDTESADEF
Database link: Q96LK0 -
Positive control
- IHC-P: Human brain tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab229712 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. |
Target
-
Relevance
C3Orf34 (HSD5) is an uncharacterized protein. This is a soluble protein with a phosphoenol pyruvate carboxylase (Ppc) domain starting near the N-terminus. The presence of a Ppc domain in HSD5 suggests that this protein may be involved in energy production and conversion pathways. The HSD5 gene is up-regulated in various tumour cell lines. -
Database links
- Entrez Gene: 613916 Cow
- Entrez Gene: 84984 Human
- Omim: 615586 Human
- SwissProt: A6H7C9 Cow
- SwissProt: Q96LK0 Human
-
Alternative names
- Centrosomal protein 19 antibody
- Centrosomal protein 19kDa antibody
- Chromosome 3 open reading frame 34 antibody
see all
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab229712 has not yet been referenced specifically in any publications.