Overview

  • Product name

    Anti-C3orf43 antibody [1H6]
    See all C3orf43 primary antibodies
  • Description

    Mouse monoclonal [1H6] to C3orf43
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human C3orf43 aa 1-214. Expressed in E.coli. (NP_001071125)
    Sequence:

    MNNETTTLISLKEAMKRVDHKLQALETQFKELDFTKDNLMQKFEHHSKAL ASQAAQDEMWTAVRALQLTSMELNILYSYVIEVLICLHTRVLEKLPDLVR GLPTLASVLRRKVKNKRVRVVWESILEECGLQEGDITALCTFFIARGNKA EHYTAKVRQMYIRDVTFLITNMVKNQALQDSLLRAVQVIEKGKAVRTPEK QKSSLEELIPSVKN


    Database link: Q147U7

  • Positive control

    • WB: C3orf43-transfected HEK-293Tcell lysate. IHC-P: Human skeletal muscle and lung tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Purified from TCS.
  • Clonality

    Monoclonal
  • Clone number

    1H6
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230681 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 25 kDa.
IHC-P Use a concentration of 10 µg/ml.

Target

Images

  • All lanes : Anti-C3orf43 antibody [1H6] (ab230681) at 1/2000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) (transfected with empty vector) cell lysate
    Lane 2 : C3orf43-transfected HEK-293T cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 25 kDa

  • Formalin-fixed, paraffin-embedded human skeletal muscle tissue stained for C3orf43 using ab230681 at 10 μg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human lung tissue stained for C3orf43 using ab230681 at 10 μg/ml in immunohistochemical analysis.

References

ab230681 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230681.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up