Overview

  • Product name

  • Description

    Rabbit polyclonal to C4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Chicken
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Chicken C4 aa 1428-1660. N-terminal tags. Expressed in E.coli.
    Sequence:

    LRDVVDHWISHYELEGNQLVLYLDEVPPERQCLSFGATQDAAVGHMQPAM AAIYDYYEPGQRCTVFYNAPQRSSTIATLCSPKICECAQGGCPQAQRRTQ EVTADDRHDFACYSPRVDYALVVRVLSQSEIGAFVAFETEIKEVLLEGQD TAVAPGERRRLLVRKSCPLRLQLHNIYLVMGGSGRTRDPEGRPQFLLGPH SWLEEVPSPGRCKATRLRGYCAQLQEFRTRLSQ


    Database link: Q076D6

  • Positive control

    • WB: Chicken serum; Recombinant chicken C4 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231943 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231943 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 179 kDa.

Target

  • Information by UniProt
  • Alternative names

    • Acidic C4 antibody
    • Acidic complement C4 antibody
    • Basic C4 antibody
    • Basic complement C4 antibody
    • C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2 antibody
    • C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3 antibody
    • C4, Chido form antibody
    • C4, Rodgers from antibody
    • C4A anaphylatoxin antibody
    • C4A antibody
    • C4A2 antibody
    • C4A3 antibody
    • C4A4 antibody
    • C4A6 antibody
    • C4AD antibody
    • C4B antibody
    • C4B_2 antibody
    • C4B1 antibody
    • C4B12 antibody
    • C4B2 antibody
    • C4B3 antibody
    • C4BD antibody
    • C4F antibody
    • C4S antibody
    • CH antibody
    • Chido form of C4 antibody
    • CO4 antibody
    • CO4A_HUMAN antibody
    • Complement C4 A antibody
    • Complement C4 B antibody
    • Complement C4 gamma chain antibody
    • complement C4-A antibody
    • complement C4-B antibody
    • complement C4-B-like antibody
    • complement C4B1a antibody
    • Complement component 4A (Rodgers blood group) antibody
    • Complement component 4A antibody
    • complement component 4B (Chido blood group) antibody
    • complement component 4B (Chido blood group), copy 2 antibody
    • Complement component 4B (Childo blood group) antibody
    • Complement component 4B antibody
    • Complement component 4F antibody
    • Complement component 4S antibody
    • CPAMD2 antibody
    • CPAMD3 antibody
    • RG antibody
    • Rodgers form of C4 antibody
    see all

Images

  • Anti-C4 antibody (ab231943) at 2 µg/ml + Chicken serum

    Predicted band size: 179 kDa

  • Anti-C4 antibody (ab231943) at 2 µg/ml + Recombinant chicken C4 protein

    Predicted band size: 179 kDa

References

ab231943 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231943.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up