Overview

  • Product name

  • Description

    Rabbit polyclonal to C4a
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Mouse C4A aa 678-761. (N-terminal His-tag and GST-tag. Expressed in E.coli).
    Sequence:

    NVNFLKALSEKLGQYSSPDAKCCCQDGMAKLPMKRTCEQRAARVPQQACR EPFLSCCKFAEDLRRDQTRSQAPLARKVRDMVNL


    Database link: B9EIU2

  • Positive control

    • WB: Recombinant mouse C4A protein: Rat serum. IHC-P: ??? ??? tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231090 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231090 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 194 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    C4 plays a central role in the activation of the classical pathway of the complement system. It is processed by activated C1 which removes from the alpha chain the C4a anaphylatoxin. The remaining alpha chain fragment C4b is the major activation product and is an essential subunit of the C3 convertase (C4b2a) and the C5 convertase (C3bC4b2a) enzymes of the classical complement pathway.
    Derived from proteolytic degradation of complement C4, C4a anaphylatoxin is a mediator of local inflammatory process. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes.
  • Involvement in disease

    Defects in C4A are the cause of complement component 4A deficiency (C4AD) [MIM:120810]. A rare defect of the complement classical pathway associated with the development of autoimmune disorders, mainly systemic lupus with or without associated glomerulonephritis.
  • Sequence similarities

    Contains 1 anaphylatoxin-like domain.
    Contains 1 NTR domain.
  • Post-translational
    modifications

    Prior to secretion, the single-chain precursor is enzymatically cleaved to yield the non-identical chains (alpha, beta and gamma). During activation, the alpha chain is cleaved by C1 into C4a and C4b, and C4b stays linked to the beta and gamma chains. Further degradation of C4b by C1 into the inactive fragments C4c and C4d blocks the generation of C3 convertase.
    N- and O-glycosylated. O-glycosylated with a core 1 or possibly core 8 glycan.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acidic complement C4 antibody
    • C3 and PZP like alpha 2 macroglobulin domain containing protein 2 antibody
    • C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2 antibody
    • C4a anaphylatoxin antibody
    • C4A antibody
    • C4AD antibody
    • CO4A_HUMAN antibody
    • Complement C4 A antibody
    • Complement C4 gamma chain antibody
    • Complement component 4A antibody
    • Complement component 4A preproprotein antibody
    • CPAMD2 antibody
    • RG antibody
    • Rodgers form of C4 antibody
    see all

Images

  • Anti-C4a antibody (ab231090) at 2 µg/ml + Rat serum

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 194 kDa

  • Anti-C4a antibody (ab231090) at 2 µg/ml + Recombinant mouse C4A

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 194 kDa

References

ab231090 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231090.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up