Overview

  • Product name

  • Description

    Rabbit polyclonal to C5a-R
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Macaque monkey, Gorilla, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human C5a-R aa 1-36.
    Sequence:

    MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVP


    Database link: P21730

  • Positive control

    • WB: PC-3, HepG2 and HEK-293 whole cell lysates. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234757 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 39 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a. This receptor stimulates chemotaxis, granule enzyme release and superoxide anion production.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications

    Sulfation plays a critical role in the association of the receptor with C5a, but no significant role in the ability of the receptor to transduce a signal and mobilize calcium in response to a small peptide agonist.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ANAPHYLATOXIN RECEPTOR antibody
    • C5a anaphylatoxin chemotactic receptor antibody
    • C5a anaphylatoxin receptor antibody
    • C5A antibody
    • C5a ligand antibody
    • C5a-R antibody
    • C5aR antibody
    • C5AR_HUMAN antibody
    • c5ar1 antibody
    • C5R1 antibody
    • CD88 antibody
    • CD88 antigen antibody
    • Complement component 5 receptor 1 antibody
    • Complement component 5 receptor 2 antibody
    • Complement component 5a receptor 1 antibody
    see all

Images

  • All lanes : Anti-C5a-R antibody (ab234757) at 1/1000 dilution

    Lane 1 : PC-3 (human prostate adenocarcinoma cell line) whole cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 3 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000000 dilution

    Predicted band size: 39 kDa

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for C5a-R (green) using ab234757 at 1/100 dilution in ICC/IF, followed by Alexa Fluor® 488 conjugated Goat Anti-Rabbit IgG (H+L).

References

ab234757 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234757.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up