Overview

  • Product name

  • Description

    Rabbit polyclonal to C5orf25
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human C5orf25 aa 532-620.
    Sequence:

    MKIQQLHPANAKTVEWDWKLLTYVMEEEGQTLPGRVLFLRYVVQTLEDDF QQTLRRQRQHLQQSIANMVLSCDKQPHNVRDVIKWLVKA


    Database link: Q8NDZ2

  • Positive control

    • ICC/IF: HEK293 cells

Properties

Applications

Our Abpromise guarantee covers the use of ab181271 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

Images

  • Immunocytochemistry/ Immunofluorescence analysis of HEK293 cells labeling C5orf25 with ab181271 1 µg/mL.

     

References

ab181271 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181271.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up