Overview

  • Product name

  • Description

    Rabbit polyclonal to C6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Recombinant fragment corresponding to Human C6 aa 521-655.
    Sequence:

    CQCAPCPNNGRPTLSGTECLCVCQSGTYGENCEKQSPDYKSNAVDGQWGC WSSWSTCDATYKRSRTRECNNPAPQRGGKRCEGEKRQEEDCTFSIMENNG QPCINDDEEMKEVDLPEIEADSGCPQPVPPENGFI


    Database link: P13671

  • Positive control

    • IHC-P: Human kidney tissue. WB: Rat liver tissue lysate; Mouse kidney tissue lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab229992 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Detects a band of approximately 105 kDa (predicted molecular weight: 105 kDa).

Target

  • Function

    Constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells.
  • Involvement in disease

    Defects in C6 are the cause of complement component 6 deficiency (C6D) [MIM:612446]. A rare defect of the complement classical pathway associated with susceptibility to severe recurrent infections, predominantly by Neisseria gonorrhoeae or Neisseria meningitidis.
  • Sequence similarities

    Belongs to the complement C6/C7/C8/C9 family.
    Contains 1 EGF-like domain.
    Contains 2 Kazal-like domains.
    Contains 1 LDL-receptor class A domain.
    Contains 1 MACPF domain.
    Contains 2 Sushi (CCP/SCR) domains.
    Contains 3 TSP type-1 domains.
  • Post-translational
    modifications

    All cysteine residues are assumed to be cross-linked to one another. Individual modules containing an even number of conserved cysteine residues are supposed to have disulfide linkages only within the same module.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • AW111623 antibody
    • C6 antibody
    • CO6_HUMAN antibody
    • Complement component 6 antibody
    • Complement component C6 antibody
    see all

Images

  • All lanes : Anti-C6 antibody (ab229992) at 1/500 dilution

    Lane 1 : Rat liver tissue lysate
    Lane 2 : Mouse kidney tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 105 kDa
    Observed band size: 105 kDa

  • Paraffin-embedded human kidney tissue stained for C6 using ab229992 at 1/100 dilution in immunohistochemical analysis.

References

ab229992 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229992.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up